SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G58600.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G58600.1
Domain Number 1 Region: 29-160
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-45
Family Necap1 N-terminal domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT3G58600.1
Sequence length 302
Sequence
MDQASSSSTMEEDKKSSTDPVNVDDNEEREAIEIALFQVPECYVYLIPPRKTAASYRADE
WDVNKWAWEGALKVVSKGEECIIKLVDKTTGELYAQAFLREGELHPVEAVIDSSRYFVLR
VEEKIDGRVRHAFIGLGFRERTEAYDFQAALHDHMKYLNKKKTAEEMEQHYQNTSSVDYS
LKEGETIVLQLKNRSDKDSKSKTVEKSLGNLSLEDKGKSIETTIPSIILPPPPPGPLSPV
TTAQKSPSSLPPSLSLQRSSEQQDLDTKREEEEEEKKEDLKAKDGGVEDAPDDDFGDFQA
AG
Download sequence
Identical sequences A0A178V7S2 Q84WV7
AT3G58600.1 NP_567071.1.80155 AT3G58600.1 3702.AT3G58600.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]