SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G60920.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G60920.1
Domain Number 1 Region: 1659-1828
Classification Level Classification E-value
Superfamily BEACH domain 3.01e-60
Family BEACH domain 0.00000163
Further Details:      
 
Domain Number 2 Region: 1547-1656
Classification Level Classification E-value
Superfamily PH domain-like 3.14e-23
Family PreBEACH PH-like domain 0.0019
Further Details:      
 
Domain Number 3 Region: 87-232
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000712
Family Clostridium neurotoxins, the second last domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT3G60920.1
Sequence length 1941
Sequence
MNGKESRGPACSFEFVGESSGLLGPGESRWPFTNGYAFATWIYIESFADTLDASTAAAAI
AAASAAKSGKISNAAPANVHTGEGTAHMPRLFSFLTPDNQGIEAYFYAQFLVVESGSGKG
SKTSLHFTHAFKPQCWYFIGLEHTCNQGLLGNSDSELRLYIDGSLYETRPFDYPRISKPL
SFCCIGSNPPSTTAGLQRRRRQCALFAEMGPVYIFKEPIGPERMTRLATRGGDVLPCFGN
GAGLPWLATNDHVRNVAEESSLSDAELGGYIHLLYHPCLLSGRFCPDASLSGAAGDEKTP
YSFSAVVFALCYLVFPYFGRPMSLLPLTVSSVHKDNLEPCSRNVPSSLTTYSLAAPIFRM
ISFAIKHPGNNEELSRTRGPEILATVLGYLLHSLASFDIKHDRVGDEELVAAIVSLCQSQ
KINHALKVQLFCTLLLDLKIWSVCSYRLQKKLLSSLQDMVFTEATAMRNADAIQVLLDGC
RRYFWTIQEKDSVNTFSLDGDARQVGEVNALVDELLVIIELLMGAASPSFAADDLHRLLG
FIIESPQPNQVARVLHLMFRLVVQPNAAKAQTFAEAFITSGGIETLLVLIANRVNTMGLE
TESFQQVKVHGSETVICETGSVTLSSSVNADRISSVSETPFNNNARNNVDDRDRVMVGII
RLIGALISKGHLKFSVGAKSDVMSNLMGSEFRENGGTMFDYKVALLLFALLKAFQAAPNR
LMTDNVYTTLLGASVNASSTEDGLNFCDLGHRFEHPQLLLILLRSLPFASKALQNRALQD
ILFLACTHPEKRSSLTKMEEWPEWILEILISNYEKDAGKQSASPGSAEEEDLIHNFLIIM
LEHSMRQKDGWKDIEATIHCAEWLTFVGGSSTGEKRIRREESLPIFKRRLLGGLLDFAAS
ELQAQTQVIAAASAGFAAESLTPKDAKAGVENAALLSVFLVENTVVILMLVEDHLRLQSK
QNCAASAVDVSPSPLSLVYPPNYRSHTLPTVGESSEVSSSCASVSSDSGGVHLDILASMA
DASGQISTAVMERLAAAAAAEPYESVSCAFVSYGSCTRDLADAWKYRSRLWYGVGLPSKT
SCFGGGGSGWDSWKHALQKDAQGNWIELPLVKKSVSMLQALLLDESGLGGGLGIGGGSGT
GMGGMSGLYQLLDSDQPFLCMLRMVLLSLREEDHGEDSLLMKNLSSEDGITGGLQCPLGN
SASVDISSQLSMRQSPSALLWSVLSPVLNMPISDSKRQRVLVTTCVLYSEVWNAVSKDKR
PLRKQYLEAILPPFVAILRRWRPLLAGIHELSTGDGVNPLVVDTRALAADALPIEAALSM
ISPEWAAAFASPPSAMALAMIAAGAAGWEAPAHPAPPAPPPLRRDSSLLERKSTKLQTFS
SFQKPLEAPNDDTPGRARDKAAANIDSHLLIQPLTRLTGVFWKLDSMESSSRMRQCLRRN
YSGTGHLETTRNYGDQTYLMNNHDSPVLAVEAISKEIMYEDDEHGDADDLEIEGNVGERK
GENEERRSGSLEDAITLSTGINDHRPLSEQNMVQNSTEVKDLSELKERIVLEISSTMVRP
LGVVKGTFQITTRRINFIVDIREDQHLDEKSDGSKSRDEERDRSWLMSSLHQIYSRRYLL
KKSALELFMVDRSNFFFDFGNTEGRRNACRAIVQARPPHLKNIYSATQPEQVSRRTQLME
RWARWEISNFEYLMQLNTLAGRSYNDITQYPIFPWILCDYVSEILDLSNPSNYRDLSKVP
IGALNPERLKKFQEKHSSFEDPVIPKFHYGSHYSSAGAVLHYLARVEPFTTLSIQLQGRK
FDRADQIFSDIAATWKGVLQDMNNVKELNTTDPNTHMVSSFSNPTTSETEPDSDMNIVST
PSNATTNQIDTESSEAANYENSNSSIKTSKNTSKITKLTPTSKRSLTSSKDNAAQKSSTK
PKLLSKAEIIKVDVYSYIMSL
Download sequence
Identical sequences F4JD14
NP_191651.3.80155 AT3G60920.1 AT3G60920.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]