SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G61420.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G61420.1
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-19
Family TFIIH domain 0.013
Further Details:      
 
Domain Number 2 Region: 111-157
Classification Level Classification E-value
Superfamily BSD domain-like 0.000000000000863
Family BSD domain 0.0034
Further Details:      
 
Domain Number 3 Region: 190-240
Classification Level Classification E-value
Superfamily BSD domain-like 0.000000011
Family BSD domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT3G61420.1
Sequence length 579
Sequence
MEKRVKYKSFVKDPGTLGSLELSEVMLLFVPNDPKSDLKLKVQTHNIKSQKYTKEGSNKP
PWLNLTSKQGRSHIFEFENYPDMHACRDFITKALAKCEEEPNKLVVLTPAEQLSMAEFEL
RFKLLRENSELQKLHKQFVESKVLTEDEFWSTRKKLLGKDSIRKSKQQMGLKSMMVSGIK
PSTDGRTNRVTFNLTSEIIFQIFAEKPAVRQAFINYVPKKMTEKDFWTKYFRAEYLYSTK
NTAVAAAEAAEDEELAVFLKPDEILAQEARQKMRRVDPTLDMDADEGDDYTHLMDHGIQR
DGTNDIIEPQNDQLKRSLLQDLNRHAAVVLEGRCINVQSEDTRIVAEALTRAKQVSKADG
EITKDANQERLERMSRATEMEDLQAPQNFPLAPLSIKDPRDYFESQQGNILSEPRGAKAS
KRNVHEAYGLLKESILVIRMTGLSDPLIKPEVSFEVFSSLTRTISTAKNILGKNPQESFL
DRLPKSTKDEVIHHWTSIQELVRHFWSSYPITTTYLSTKVGKLKDAMSNTYSLLDAMKQS
VQSDLRHQVSLLVRPMQQALDAAFQHYESDLQRRTAKIT
Download sequence
Identical sequences Q9M322
AT3G61420.1 AT3G61420.1 NP_191701.4.80155 3702.AT3G61420.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]