SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G61723.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G61723.1
Domain Number 1 Region: 3-41
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000309
Family PHD domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT3G61723.1
Sequence length 73
Sequence
MYYVCCDGRNVWVHAGCDIITNERFKELEHNNYYCPDCKVLESLFPDTTRSGCTPLWIRN
AAAKRGSREDRSR
Download sequence
Identical sequences A0A178VQ92 B3H691
3702.AT3G61723.1-P AT3G61723.1 NP_001118880.1.80155 AT3G61723.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]