SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G61740.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G61740.1
Domain Number 1 Region: 868-1015
Classification Level Classification E-value
Superfamily SET domain 1.83e-43
Family Histone lysine methyltransferases 0.0078
Further Details:      
 
Domain Number 2 Region: 181-307
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.05e-22
Family PWWP domain 0.0021
Further Details:      
 
Domain Number 3 Region: 547-611
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000606
Family PHD domain 0.01
Further Details:      
 
Domain Number 4 Region: 361-420
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000864
Family PHD domain 0.0022
Further Details:      
 
Weak hits

Sequence:  AT3G61740.1
Domain Number - Region: 447-506
Classification Level Classification E-value
Superfamily SAND domain-like 0.000105
Family SAND domain 0.011
Further Details:      
 
Domain Number - Region: 657-690
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0707
Family PHD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT3G61740.1
Sequence length 1018
Sequence
MILKRTLTTFENQNLKRCKIDSEIEYGRKKGEIIVYKKRQRATVDQPCSKEPELLTSSSS
SLTSKEESQQVCSDQSKSSRGRVRAVPSRFKDSIVGTWKSSRRKGESTESSHDDDDVSLG
KKVKGFSGSSKLHRSKDSKVFPRKDNGDSSEVDCDYWDVQISYDDANFGMPKKSDASRKG
VYKPEEFTVGDLVWAKCGKRFPAWPAVVIDPISQAPDGVLKHCVPGAICVMFFGYSKDGT
QRDYAWVRQGMVYPFTEFMDKFQDQTNLFNYKASEFNKALEEAVLAENGNFGDAEIISPD
SSATESDQDYGPASRFQGSYHEDIRTCDGCGSVMPLKSLKRTKDSQPEELLCKHCSKLRK
SNQYCGICKRIWHPSDDGDWVCCDGCDVWVHAECDNITNERFKELEHNNYYCPDCKVQHE
LTPTILEEQNSVFKSTEKTTETGLPDAITVVCNGMEGTYIRKFHAIECKCGSCGSRKQSP
SEWERHTGCRAKKWKYSVRVKDTMLPLEKWIAEFSTYTLETQMLDKQKMLSLLEEKYEPV
RAKWTTERCAVCRWVEDWEENKMIICNRCQVAVHQECYGVSKSQDLTSWVCRACETPDIE
RDCCLCPVKGGALKPSDVEGLWVHVTCAWFRPEVGFLNHENMEPAVGLFKIPANSFLKVC
TICKQTHGSCVHCCKCATHFHAMCASRAGYNMELHCLEKNGVQRTRKSVYCSFHRKPDPD
SVVVVHTPSGVFGSRNLLQNQYGRAKGSRLVLTKKMKLPGFQTQTQAEQSRVFDSLSAAR
CRIYSRSNTKIDLEAISHRLKGPSHHSLSAIENLNSFKASFSFRAPFMSVFCFLGATFSE
YLRKILISIYLVTHQEADFTSFRERLKHLQRTENFRVCFGKSGIHGWGLFARKSIQEGEM
IIEYRGVKVRRSVADLREANYRSQGKDCYLFKISEEIVIDATDSGNIARLINHSCMPNCY
ARIVSMGDGEDNRIVLIAKTNVAAGEELTYDYLFEVDESEEIKVPCLCKAPNCRKFMN
Download sequence
Identical sequences Q9M364
AT3G61740.1 AT3G61740.1 NP_191733.3.80155 3702.AT3G61740.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]