SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G61740.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G61740.2
Domain Number 1 Region: 832-979
Classification Level Classification E-value
Superfamily SET domain 1.83e-43
Family Histone lysine methyltransferases 0.0078
Further Details:      
 
Domain Number 2 Region: 181-307
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.75e-22
Family PWWP domain 0.0021
Further Details:      
 
Domain Number 3 Region: 547-611
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000576
Family PHD domain 0.01
Further Details:      
 
Domain Number 4 Region: 361-420
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000443
Family PHD domain 0.002
Further Details:      
 
Domain Number 5 Region: 447-506
Classification Level Classification E-value
Superfamily SAND domain-like 0.0000994
Family SAND domain 0.011
Further Details:      
 
Weak hits

Sequence:  AT3G61740.2
Domain Number - Region: 657-690
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0681
Family PHD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT3G61740.2
Sequence length 982
Sequence
MILKRTLTTFENQNLKRCKIDSEIEYGRKKGEIIVYKKRQRATVDQPCSKEPELLTSSSS
SLTSKEESQQVCSDQSKSSRGRVRAVPSRFKDSIVGTWKSSRRKGESTESSHDDDDVSLG
KKVKGFSGSSKLHRSKDSKVFPRKDNGDSSEVDCDYWDVQISYDDANFGMPKKSDASRKG
VYKPEEFTVGDLVWAKCGKRFPAWPAVVIDPISQAPDGVLKHCVPGAICVMFFGYSKDGT
QRDYAWVRQGMVYPFTEFMDKFQDQTNLFNYKASEFNKALEEAVLAENGNFGDAEIISPD
SSATESDQDYGPASRFQGSYHEDIRTCDGCGSVMPLKSLKRTKDSQPEELLCKHCSKLRK
SNQYCGICKRIWHPSDDGDWVCCDGCDVWVHAECDNITNERFKELEHNNYYCPDCKVQHE
LTPTILEEQNSVFKSTEKTTETGLPDAITVVCNGMEGTYIRKFHAIECKCGSCGSRKQSP
SEWERHTGCRAKKWKYSVRVKDTMLPLEKWIAEFSTYTLETQMLDKQKMLSLLEEKYEPV
RAKWTTERCAVCRWVEDWEENKMIICNRCQVAVHQECYGVSKSQDLTSWVCRACETPDIE
RDCCLCPVKGGALKPSDVEGLWVHVTCAWFRPEVGFLNHENMEPAVGLFKIPANSFLKVC
TICKQTHGSCVHCCKCATHFHAMCASRAGYNMELHCLEKNGVQRTRKSVYCSFHRKPDPD
SVVVVHTPSGVFGSRNLLQNQYGRAKGSRLVLTKKMKLPGFQTQTQAEQSRVFDSLSAAR
CRIYSRSNTKKIDLEAISHRLKGPSHHSLSAIENLNSFKEADFTSFRERLKHLQRTENFR
VCFGKSGIHGWGLFARKSIQEGEMIIEYRGVKVRRSVADLREANYRSQGKDCYLFKISEE
IVIDATDSGNIARLINHSCMPNCYARIVSMGDGEDNRIVLIAKTNVAAGEELTYDYLFEV
DESEEIKVPCLCKAPNCRKFMN
Download sequence
Identical sequences F4JFG2
NP_001078326.1.80155 AT3G61740.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]