SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G01800.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G01800.1
Domain Number 1 Region: 92-302,423-470
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.72e-76
Family Tandem AAA-ATPase domain 0.000000406
Further Details:      
 
Domain Number 2 Region: 766-987
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 1.05e-60
Family Helical scaffold and wing domains of SecA 0.0000424
Further Details:      
 
Domain Number 3 Region: 471-580,677-760
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.94e-49
Family Tandem AAA-ATPase domain 0.0000133
Further Details:      
 
Domain Number 4 Region: 301-423
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 7.72e-44
Family Pre-protein crosslinking domain of SecA 0.0000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT4G01800.1
Sequence length 1022
Sequence
MVSPLCDSQLLYHRPSISPTASQFVIADGIILRQNRLLSSSSFWGTKFGNTVKLGVSGCS
SCSRKRSTSVNASLGGLLSGIFKGSDNGESTRQQYASIVASVNRLETEISALSDSELRER
TDALKQRAQKGESMDSLLPEAFAVVREASKRVLGLRPFDVQLIGGMVLHKGEIAEMRTGE
GKTLVAILPAYLNALSGKGVHVVTVNDYLARRDCEWVGQVPRFLGLKVGLIQQNMTPEQR
KENYLCDITYVTNSELGFDYLRDNLATSVEELVLRDFNYCVIDEVDSILIDEARTPLIIS
GPAEKPSDQYYKAAKIASAFERDIHYTVDEKQKTVLLTEQGYEDAEEILDVKDLYDPREQ
WASYVLNAIKAKELFLRDVNYIIRAKEVLIVDEFTGRVMQGRRWSDGLHQAVEAKEGLPI
QNESITLASISYQNFFLQFPKLCGMTGTASTESAEFESIYKLKVTIVPTNKPMIRKDESD
VVFKAVNGKWRAVVVEISRMHKTGRAVLVGTTSVEQSDELSQLLREAGITHEVLNAKPEN
VEREAEIVAQSGRLGAVTIATNMAGRGTDIILGGNAEFMARLKLREILMPRVVKPTDGVF
VSVKKAPPKRTWKVNEKLFPCKLSNEKAKLAEEAVQSAVEAWGQKSLTELEAEERLSYSC
EKGPVQDEVIGKLRTAFLAIAKEYKGYTDEERKKVVEAGGLHVVGTERHESRRIDNQLRG
RSGRQGDPGSSRFFLSLEDNIFRIFGGDRIQGMMRAFRVEDLPIESKMLTKALDEAQRKV
ENYFFDIRKQLFEFDEVLNSQRDRVYTERRRALVSDSLEPLIIEYAELTMDDILEANIGP
DTPKESWDFEKLIAKVQQYCYLLNDLTPDLLKSEGSSYEGLQDYLRARGRDAYLQKREIV
EKQSPGLMKDAERFLILSNIDRLWKEHLQALKFVQQAVGLRGYAQRDPLIEYKLEGYNLF
LEMMAQIRRNVIYSIYQFQPVRVKKDEEKKSQNGKPSKQVDNASEKPKQVGVTDEPSSIA
SA
Download sequence
Identical sequences Q9SYI0
3702.AT4G01800.1-P AT4G01800.1 NP_192089.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]