SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G02450.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G02450.2
Domain Number 1 Region: 1-156
Classification Level Classification E-value
Superfamily HSP20-like chaperones 2.97e-30
Family Co-chaperone p23-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT4G02450.2
Sequence length 240
Sequence
MSRHPEVKWAETTEKIFLTVVLADTKDTKVNLDPEGVFDFSAKVGPENHVYELKLELADK
VNVEESKINIGERSIFCIIEKAEPERWNKLLRVKKPPHYVKVDWDKWVDEDDEGSAGAAD
MDMAGMEGMGGMGGMGGMGGMGGMGGMGGMGGMEGMDFSKLMGGMGGMGGMGGLEGLGGM
GGMGGMGGMGGMGGMEEFEDSDDEETAKSGDKKDDAVKEEGLATEKAPAAEETTSVKEDK
Download sequence
Identical sequences F4JHJ0
AT4G02450.2 NP_001154201.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]