SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G02660.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G02660.1
Domain Number 1 Region: 2899-3188
Classification Level Classification E-value
Superfamily BEACH domain 1.15e-121
Family BEACH domain 0.0000000229
Further Details:      
 
Domain Number 2 Region: 3249-3443,3472-3523
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.04e-29
Family WD40-repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 2707-2759,2821-2871
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-16
Family PreBEACH PH-like domain 0.036
Further Details:      
 
Domain Number 4 Region: 697-893,920-1010
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000338
Family HspBP1 domain 0.021
Further Details:      
 
Domain Number 5 Region: 178-314,493-634,727-821
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000161
Family Armadillo repeat 0.07
Further Details:      
 
Domain Number 6 Region: 1131-1240
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000837
Family Laminin G-like module 0.057
Further Details:      
 
Weak hits

Sequence:  AT4G02660.1
Domain Number - Region: 1546-1605,1662-1732,1780-1817,2328-2371
Classification Level Classification E-value
Superfamily ARM repeat 0.000453
Family Mo25 protein 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT4G02660.1
Sequence length 3527
Sequence
MKWGTLLKDLKDKVGVAETTADLIAGEAISDPTTPPSSSQASPSSSFAALAQHDFNLLSP
TSRDKLKLELDFKRYWEEFRSSSSEQEKEAALNLSVNTFCRLVKQHANVDQLVTMLVEPH
IFSFVIGRAFVADVEKLKVSSRKRSLDVEKAIEFFSEVTKDGSSHGANLLTAIEVLASGP
FDKQSLLDSGILCCLIHTFNAFLTYSVASEGEKTVNYEEKVEGSVVNIMKALASHPSAAQ
SLIEDDSLQLLFKMVANGSLMAFSRFKVGLVSFHNIQLHKNAMQILGLLLVNDNGSTASY
IRKHHLIKVLLMAVKDFDPDCGDSAYTVGIVDLLLECVELSYRPETGGVRLKDDIRNAHG
YHFLVQFALILSSMPKDIVFAFDHSSPHKNRGSNDSKKQPPLSLKTRQNDDSEKQQSLSL
NSRQNDEFALKHFSPALSRLLDVLVTLAQTGPIESSGTSTSLLSQTKLTGYSRRQTPSAN
NRYDEPCEQGSGKVKDLEAVQMLQDIFLKAENKDLQAEVLNRMFKIFTSHLENYRICQEL
KTVPLLVLNMGGFPSSLQELILKILEYAVTVVNCVPEQELLSLCFLLQQPIDSELKHTIL
SFFVKLTSFDQQYKKVLGEVGVLEVLQDDLKQHKLLRGPDQYSGVSNHLDRVPSSPSFKQ
HLDSQDAIISSPKLMESGSGKLPIFEVERTITVGWDCMISLLKNSQVNQEAFRSANGVTV
ILPFLIADEHRTSILRIFSCLITGDIKQVHHEELEALIDVLKSGMVTRVSGDQYKLHYEV
RCDIMGALWRIVGVNGSAQRVFGEATGFSLLLTTLHTFQGEEECRDESHLMVYIKLFKHL
LRLITTAVCENAINRMKLHSVITSQTFYDLLVESGLLCVDLERHVIQLLLELALEVLVPP
FLTSESMASAEMAECEKASFLVKTASGQFNPDKQKIYNAGAVRVLIRSLLLCTPKLQLEF
LNLLERLARASPFNKETLTSAGCVELLLEIIYPFLQGSSPFLSHALKIVEVLGAYRLSPS
ELKMLCRYVMQMRVMNSGPSLIGMMEKLILMEEDTGLECVSLAPFVEMDMSKTGHASVQV
SLGERSWPPAAGYSFVCWVQFRNFLTTQELESEVYKAGGSSKTPILSGQQSEQNIFRIFS
VNAISNGSPSYAELYFQEDGILTLATSNSNSLSFSGLETEEGKWHHLAVVHSKPNALAGL
FQASVAYVYIDGKLRHMGKLGYSPSPVGKSLQVIIGTSATCARACGGDSMAILDLLDTDM
SSGIQKFEDSNRQGDSKAHCSGIVWDLDRLGNLSIQLPGKKLIFAFDGTCSEFMRATGSF
SLVNLVDPLSAAASLIGGIPRFGRLVGNVSLCRQNVIGNSIRPVGGMAVVLALVEAAESR
DMLHMALSLLACALHQNSQNVKDMETYTGYHLLALFLRPKMALFDMQCLEIFFQISACEA
FFSEPKKLESGQTTISMSPTEIIPENNYEDPTLCKFQYETSSVGSHGDMDDFSGRKDSFS
HLSELEMGDNPVETSNCIVLSNADMVEHVLLDWTLWVTAPVSIQIASLGFLENLISILWY
RSHNLAILRQINLVKHLLVTLQRGDVEVLVLEKLVILLRCILENGFLTPELEDVVRFAIM
TFNPPEIKSQNSSMRESMGKHVIVRNLVLEMLIDLQVTIKAEELLEQWHKTVSSKLITYF
LDGAVHPSSMRWIMTLLGVCLTSSPNFSLKFFASGGYQGLVRVLQSFYDSPDIYYILFCL
IFGKPVYPRLPEVRMLDFHALMPDDGSHVELNFVDLLDSVVAMAKSTFDRLIMQSMLAHQ
SGNLSQVSARCVAELVEGYADMTGELQGKALMHKTYAARLMGGEASAPATATSVIRFMVD
LAKMCPQFSAACKNTEFLQKCADLYFSCVRAFHAVKLAKQLSMKAEEQNITGGDDSSVEG
NFCRVSHQDMSTKTSISAGSFPQDQTSSVISVDMYIPSDYVAVDKVENFLTTPPGESNKS
FQGREYIAKQDGDHVGSVSASSEMKSLDLTGSSSQVQPIDSRSSESFSMLESPLLSEKSS
LEVPFIPSPSKSSTISTPHPSHISVSEFDASSDQSSGSQGSSAVHTLFTISPKVLLETDE
SGYGGGPCSAGASAVLDFMAEVCADIMTEQIKAVQALESILEMLPLYVDPECVVVFQGLC
LSRVMNYLERRFLRDDEEDDKKLDKRKWSANLDAFCWMIVDRVYMGAFPQPTGVLRTLEF
LLSILQLANKDGRVEEVTSSGKGLLSIGRATRQLDAYVHSILKNTNRTILYCFLPSFLIT
IGEEDLPSRLGLLVESTKKQTSKLSGKESGIDVSAVLQLLVANKNIILCPSNLDTDLNCC
LCVNLISLLHDQRKNVQNMASNIIKYLLVHRKSALEDLLVKKPHRGQKFDVLHGGFDRLL
TGNLPEFSKWLESSEQIITKVLEQGAAVMWIQYIAGSAKFPDVRMKGMDGRRTREMGRKL
RDTSKLDLKHWEQVNERRYALEVVRDAMSAELRVVRQNKYGLILHAESVWPTHLQQLVHE
RGIFPMRISHGVEDLKWQLCPIEGPYRMRKKLERCKLKIDSLHNLLEGKLELGEIELLKS
KSEDGLVISDMDSEPAFLLSELYSESFSEEADDLKDVPSARNGWNNDRATSTNAASLHNS
LSFGGKSSSTAVSVPISVNTDEKSETGSPIKSSSGKMDEIKHVEEESEKELKDDGEYLIR
PYLEHLEKIRFRYNCERVVGLDKHDGIFLIGELCLYVIENFYIDDHGCICEKECEDELSI
IDQAQGLKKQFHGSLESKSKSSTLWSTTIKIGAVGGRAWAYGGGAWGKEKVRVTGNLPHP
WHMWKLDSVHEILKRDYELRRVAVEIFSMDGCNDLLVFHKKEREEVFRNLLAMNLPRNSM
LDTTISGSAKQESKEGSRLFKLMAKSFTKRWQNGEISNFQYLMHLNTLAGRGYSDLTQYP
VFPWILADYDGESLDLSDPNNFRKLDKPMGCQTPEGEEEFRKRYESWDDPEVPQFHYGSH
YSSAGIVLFYLIRLPPFSAENQKLQGGQFDHADRLFNSIRETWLSAAGKGNTSDVKELIP
EFFYMPEFLENRFNLDLGEKQSGDKVGDVILPPWARGSVREFIRKHREALESDYVSENLH
HWIDLIFGHKQRGKAAENAVNVFYHYTYEGNVDVDAVTDPAMKASILAQINHFGQTPKQL
FQKPHVKRRTDRKVPPHPLKHSMHLVPRNIRKCSSSINQIITFNDKLLLTGANCLLKPRG
YKKYIRWGFPDRTLRFMSYDQDKLLSTHENLHEGNQIQCAGVSHDGRIVVTGAEDGLVSV
WRVSKDGPRGSRRLRLEKSLCAHTAKVICLRVSQPYMMIASSSDDCTVIIWDLSSLSFVR
QLPNFSVPVTVVYINDLTGEIVTAAGSVLAVWSINGDCLSVVNTSQLPTDLIVSVAGSTF
SDWLETTWYVTGHQSGALKVWRMVHCTDPVSVPSKTPSNRTGGLNLGNQKPEYKLLLHKE
LKFHKQPVTSLHLTTDLKQLLSGDSAGHLLSWTVPDEILKASLKKAS
Download sequence
Identical sequences F4JHT3
AT4G02660.1 AT4G02660.1 NP_001319850.1.80155 NP_192175.3.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]