SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G04260.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G04260.1
Domain Number 1 Region: 102-160
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000031
Family PHD domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT4G04260.1
Sequence length 193
Sequence
MRPSDAGKAPYVARVEKIEADARNNVKVHCRWYYCPEESHGGRRQLHGAKELFLSDHFDV
QSAHTIEGKCIVHTFKNYTRLENVGVEDYYCIFDYKAATGAFTPDRVAVYYKCEMPYNSD
ELMELLLCHYRVHLACVGVTIEEAKKLEHFVCVECSSDEDGVKRFQNGFASSTTNDLKPS
AEKMIDVRASYEL
Download sequence
Identical sequences AT4G04260.1 NP_192335.2.80155 AT4G04260.1 3702.AT4G04260.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]