SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G05630.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G05630.1
Domain Number 1 Region: 14-112
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000334
Family B3 DNA binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT4G05630.1
Sequence length 124
Sequence
MANFPDKQYDSNNPYNIMITLSPFDVDRSTTIMMPKALLETNLFPFMEISTLVQLLQVQD
KPKMIGVYDIDTQITTYVIIRQDGNNFKFHGWNDILKRKHYKAGDTIAFWWDLRHTRLNF
KHVA
Download sequence
Identical sequences Q9M0U1
3702.AT4G05630.1-P GO.19394 AT4G05630.1 NP_192472.1.80155 AT4G05630.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]