SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G08180.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G08180.1
Domain Number 1 Region: 432-806
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 3.53e-116
Family Oxysterol-binding protein 0.00057
Further Details:      
 
Domain Number 2 Region: 107-143,183-241
Classification Level Classification E-value
Superfamily PH domain-like 4.19e-20
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT4G08180.1
Sequence length 814
Sequence
MHPFCCVTTVSDHSPSMPPLPEPQPPLPNYAADFGSARSEPIITRSASQSYNHSGQFNNN
LIHSLSFNHHQSDVTDRLGQRVLALPAAVREPPVDVKINDIVGNGIAGILYKWVNYGRGW
RPRWFVLQDGVLSYYKIHGPDKIFVSPETEKGSKVIGDESARMISRHNRRGGSSSSCQLR
RKPFGEVHLKVSSVRESRSDDKRFSIFTGTKRLHLRAETREDRTTWVEALQAVKDMFPRM
SNSELMAPTNNLAMSTEKIRLRLIEEGVSELAIQDCEQIMKSEFSALQSQLVLLKQKQWL
LIDTLRQLETEKVDLENTVVDESQRQADNGCSGELRHEKFSEGTATESDDDNERGDAAEE
EFDEEENTFFDTRDFLSSSSFKSSGSGFRTSSFSSDEDGFESEDDIDPSIKSIGCNYPRV
KRRKNLPDPVEKEKSVSLWSMIKDNIGKDLTKVCLPVYFNEPLSSLQKCFEDLEYSYLLD
RAFEYGKRGNSLMRILNVAAFAVSGYASTEGRICKPFNPLLGETYEADYPDKGLRFFSEK
VSHHPMVVACHCDGTGWKFWGDSNLRSKFWGRSIQLDPVGVLTLQFDDGEILQWSKVTTS
IYNLILGKLYCDHYGTMRIEGSAEYSCKLKFKEQSIIDRNPHQVHGIVQNKSGKTVATMF
GKWDESIHFVTGDCSGKGKLSEDMSGAQLLWKRSKPPGNATKYNLTRFAITLNELTPGLK
ERLPPTDSRLRPDQRYLENGEFEMANTEKLRLEQRQRQARKMQERGWKPRWFMKEKGSES
YRYKGGYWEAREDGSWVDCPDIFGHIDSDQQMIE
Download sequence
Identical sequences Q8L751
3702.AT4G08180.1-P NP_001319881.1.80155 NP_192558.2.80155 AT4G08180.1 AT4G08180.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]