SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G08180.3 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G08180.3
Domain Number 1 Region: 431-805
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 3.27e-114
Family Oxysterol-binding protein 0.00071
Further Details:      
 
Domain Number 2 Region: 107-143,183-241
Classification Level Classification E-value
Superfamily PH domain-like 4.19e-20
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT4G08180.3
Sequence length 813
Sequence
MHPFCCVTTVSDHSPSMPPLPEPQPPLPNYAADFGSARSEPIITRSASQSYNHSGQFNNN
LIHSLSFNHHQSDVTDRLGQRVLALPAAVREPPVDVKINDIVGNGIAGILYKWVNYGRGW
RPRWFVLQDGVLSYYKIHGPDKIFVSPETEKGSKVIGDESARMISRHNRRGGSSSSCQLR
RKPFGEVHLKVSSVRESRSDDKRFSIFTGTKRLHLRAETREDRTTWVEALQAVKDMFPRM
SNSELMAPTNNLAMSTEKIRLRLIEEGVSELAIQDCEQIMKSEFSALQSQLVLLKQKQWL
LIDTLRQLETEKVDLENTVVDESQRQADNGCSGELRHEKFSGTATESDDDNERGDAAEEE
FDEEENTFFDTRDFLSSSSFKSSGSGFRTSSFSSDEDGFESEDDIDPSIKSIGCNYPRVK
RRKNLPDPVEKEKSVSLWSMIKDNIGKDLTKVCLPVYFNEPLSSLQKCFEDLEYSYLLDR
AFEYGKRGNSLMRILNVAAFAVSGYASTEGRICKPFNPLLGETYEADYPDKGLRFFSEKV
SHHPMVVACHCDGTGWKFWGDSNLRSKFWGRSIQLDPVGVLTLQFDDGEILQWSKVTTSI
YNLILGKLYCDHYGTMRIEGSAEYSCKLKFKEQSIIDRNPHQVHGIVQNKSGKTVATMFG
KWDESIHFVTGDCSGKGKLSEDMSGAQLLWKRSKPPGNATKYNLTRFAITLNELTPGLKE
RLPPTDSRLRPDQRYLENGEFEMANTEKLRLEQRQRQVIQMQERGWKPRWFMKEKGSESY
RYKGGYWEAREDGSWVDCPDIFGHIDSDQQMIE
Download sequence
Identical sequences AT4G08180.3 NP_974518.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]