SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G10600.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G10600.1
Domain Number 1 Region: 4-62
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000332
Family PHD domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT4G10600.1
Sequence length 237
Sequence
MKPHEDWVYESWTVDCVCGVNFDDGKEMVDCDECGVWVHTWCSRYVKGDDLFVCHKCKIK
NNEDELSKLSVTKSLRMENLCTQSSESVVLKACSEIPIEERVHVQGVPGGDLGLFECVSS
VFSRQLWKCSGYVPKKFRFQCREFPCWDEKENVCDVVGDEDDSNLAGVLLSMSKENGVDG
KGDNARNCGSREIESDVEKEKSLLCDPLSIYKRRNESVGGFEDGVKKKVKVADKEEE
Download sequence
Identical sequences Q9T0B9
GO.19121 NP_001319895.1.80155 NP_192798.1.80155 3702.AT4G10600.1-P AT4G10600.1 AT4G10600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]