SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G11790.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G11790.1
Domain Number 1 Region: 304-439
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-19
Family Ran-binding domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT4G11790.1
Sequence length 443
Sequence
MRGVKRAAISESNDSPFKNAKPVEGIFFGTQKNVVPMQQSSVTSASLDKQRAELARKHVR
ALNNQFVSWVQLQLKNHPDELWEDGMNDYITHASNILEKFKDVVSWLKENKGKGENLSPE
SRGAENKLVAEVKNTNVKSFSNNIPFASNNQPGIFSNNQSSDFSSSQSGFFSSQSGAFSS
SPSGLISNSQTGSFSSGQFGTTKSSQPSLFSGSQAGAISNSQPGTFSSSHSGITSNSQTG
SFSSGQFGQTKSSQPSLLSGSQAGAISSNQPSFQFSNSQSPFTSAVPPVSIPAKQDHSDD
ADGGDEQSQPSSPSVKKTEEKGITVVHEVKCKLYVKSSDPADKGWKDKGTGNLYIKCKEG
VDKGTKESKPTILVRNDVGKLLLNALLYAGMKTSPQKNALVAIFHSSDDSNENVTPRTFL
IRTKNAEARDNLATAIQEYAPSS
Download sequence
Identical sequences Q93ZH3
AT4G11790.1 3702.AT4G11790.1-P NP_567381.1.80155 AT4G11790.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]