SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G12460.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G12460.1
Domain Number 1 Region: 318-686
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 7.45e-116
Family Oxysterol-binding protein 0.0005
Further Details:      
 
Domain Number 2 Region: 27-58,96-151
Classification Level Classification E-value
Superfamily PH domain-like 2.77e-16
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT4G12460.1
Sequence length 693
Sequence
MPLTRSKSLPATENGGSDRETLQSGRSVAGILYKWTNYGKGWRSRWFLLRDGILSYSKIR
RPENVNLLSPSDDLRLIGDISTDRLLRMKSCSGRSRRKHHKNIGIVHLKVSSYRESKSDH
RKFYIFTATKTLHLRTDSRSDRAAWLQALASTRGIVPLQSINGDFSFVSPKDLSISTERL
KKRLFEEGMNESLVKECEQIVDSEFCEVQEQIKLLHEERKKLLDALRQLEMANLEAEASG
IHDDVYQLRNHKYSSLGRGKYSECSTSASSDDKQEFEDISEEDEASFHDTKESFGEPDVG
SVLTHFKRRTKLPDPAEKERGVSLWSMIKDNVGKDLTRVCLPVYFNEPISSLQKCFEDLE
YSYLLDQAYEYGKSGKSLLRALNVAAFAVSGYASTEGRHCKPFNPLLGETYEADFPEKGI
RFFSEKVSHHPTVIACHCEGKGWKFWGDTNLRSKFWGRSIQLEPVGILTLEFDDGEIFQW
SKVTTTIYNILLGKLYCDHHGIMKIRGNRQYSCMLKFKEQSILDRNPHQVNGFVEDVTGK
KAATVFGKWNDSLYYVAGDGINKASASLLWKATKAPPNVTRYNFTSFAMTLNELIPGLEE
KLPPTDSRLRPDQRHLENGEYEKANEEKQRLERRQRMSRQIQESGWRPRWFEPQGESESY
KYTGGYWEARDVKSWDDCPNIFGEFTEEVADCA
Download sequence
Identical sequences Q9SU36
3702.AT4G12460.1-P AT4G12460.1 NP_001327962.1.80155 NP_192983.2.80155 AT4G12460.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]