SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G12620.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G12620.1
Domain Number 1 Region: 433-675
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.48e-34
Family Extended AAA-ATPase domain 0.044
Further Details:      
 
Domain Number 2 Region: 155-218
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.99e-17
Family PHD domain 0.0041
Further Details:      
 
Weak hits

Sequence:  AT4G12620.1
Domain Number - Region: 286-332
Classification Level Classification E-value
Superfamily BAH domain 0.0942
Family BAH domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT4G12620.1
Sequence length 813
Sequence
MASTPRAKTFKSPTKTPSNIYRKSYLSPSSTSHTPQTPETHTPLRRSARHVSRKIDLGND
PIDAPGNDPIEGMNLIRKRERAPRKPTTDVVPSKSKKTETPKKKKKIDSFTPVSPIRSET
IKKTKKKKRVYYNKVEFDETEFEIGDDVYVKRREDSNSDEEEDPEIEDCQICFKSDTNIM
IECDDCLGGFHLKCLKPPLKEVPEGDWICQFCEVKKSGQSQTLDLPKPPEGKKLARTMRE
KLLSGDLWAARIDKLWKEVDDGVYWIRARWYMIPEETVSGRQPHNLKRELYLTNDFADIE
MECILRHCSVKCPKEFSKASNDGDDVFLCEYEYDVHWRSFKRLAELADGDSDSDQEWNGR
KEEEVDDSDEEMELDDEVLKSKRGGLTSARGGANSRKGRFFGVEKVGMKLIPEHVRCHKQ
SELEKAKATLLLATRPKSLPCRSKEMEEITSFIKGSISDDQCLGRCMYIHGVPGTGKTIS
VLSVMKNLKAEVEEGSVSPYCFVEINGLKLASPENIYSVIYEALSGHRVGWKKALQCLNE
RFAEGKRIGKEDEKPCILLIDELDLLVTRNQSVLYNILDWPTKPNSKLVVLGIANTMDLP
EKLLPRISSRMGIQRLCFGPYNHTQLQEIISTRLNGIDAFEKTAIEFASRKVAAISGDAR
RALEICRRAAEVADHRLNTNKSAKNQLVIMADVEAAIQEMFQAPHIQVMKSVSKLSKIFL
TAMVHELYKTGMAETTFDRVATTVSSICLTNGEAFPGWDILLKIGCDLGECRIILCEPGE
KHRLQKLQLNFPSDDVAFALKDNKDLPWLANYL
Download sequence
Identical sequences A0A178UTR9 Q9SU24
AT4G12620.1 AT4G12620.1 3702.AT4G12620.1-P NP_192999.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]