SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G12850.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AT4G12850.1
Domain Number - Region: 6-32
Classification Level Classification E-value
Superfamily PH domain-like 0.0271
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT4G12850.1
Sequence length 183
Sequence
MTGDLKLDEPYVGLKFESEEEAKDFYVEYSKRLGFVVRMMQRRRSGIDGRTLARRLGCNK
QGFGPNNQRSSSSSSSSREGCKATILVKMEKSGKWVVTRFIKEHNHSLQFIGSSSYDSFA
DKERKIKELTEEIECQDRLCDVYRDRLVSFIDNVEHYTEELSLKVRDIVENVKKLECQIQ
TRA
Download sequence
Identical sequences Q9SU01
GO.17959 3702.AT4G12850.1-P AT4G12850.1 AT4G12850.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]