SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G13040.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G13040.1
Domain Number 1 Region: 117-161
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000000000562
Family GCC-box binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT4G13040.1
Sequence length 226
Sequence
MVSLRRRRLLGLCCGPNGYVTPLPFLTAEEMITGIPNPNARAAYNPGPAETVTTVIVEKK
AIEERSRRTRSKHMHFRSDYSDISPVNSDSISPKYQPPKRRKQHRRKRVHNQEPCLMRGV
YYKNMKWQAAIKVEKKQIHLGTFSSQEEAARLYDRAAFMCGREPNFELSEEVIRELKQQS
WEEFLNCTRRTITNKKPKSRIEHEDTKINASMPHQPEEEEQDSDKM
Download sequence
Identical sequences Q56XP9
NP_193040.2.80155 AT4G13040.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]