SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G14368.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G14368.1
Domain Number 1 Region: 229-615
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.7e-91
Family Regulator of chromosome condensation RCC1 0.0004
Further Details:      
 
Domain Number 2 Region: 18-128
Classification Level Classification E-value
Superfamily PH domain-like 4.79e-24
Family Pleckstrin-homology domain (PH domain) 0.0028
Further Details:      
 
Domain Number 3 Region: 614-686
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.87e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0016
Further Details:      
 
Weak hits

Sequence:  AT4G14368.1
Domain Number - Region: 820-879
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0366
Family C-terminal domain of PLC-beta 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT4G14368.1
Sequence length 1106
Sequence
MKTDGMADPSSYVNHDRDIDQALVSLKKGTQLLKYSRKGRPKFRSFRLSPDETTLFWLSH
GEEKGLKLATVSRILPGQRTAVFRRYLRPEKDYLSFSLIYHNGDRSLDLICKDKAETEVW
FAGLKSLIRQNRNKQAKSEIPEVSIHDSDCFSTGRPSTASIDFAPNNTRRGRTSIDLGIQ
NSPTKFGSSDVGYERGNMLRPSTDGFRISVSSTPSCSTGTSGPDDIESLGDVYVWGEVWS
DGISPDGVVNSTTVKIDVLIPKPLESNVVLDVHQIACGVRHIALVTRQGEVFTWEEEAGG
RLGHGIQVDVCRPKLVEFLALTNIDFVACGEYHTCAVSTSGDLFTWGDGIHNVGLLGHGS
DLSHWIPKRVSGPVEGLQVLSVACGTWHSALATANGKLFTFGDGAFGVLGHGDRESVSYP
KEVKMLSGLKTLKVACGVWHTVAIVEVMNQTGTSTSSRKLFTWGDGDKNRLGHGNKETYL
LPTCVSSLIDYNFNQIACGHTFTVALTTSGHVFTMGGTSHGQLGSSNSDGKLPCLVQDRL
VGEFVEEISCGDHHVAVLTSRSEVFTWGKGSNGRLGHGDKDDRKTPTLVEALRERHVKSI
SCGSNFTSSICIHKWVSGADQSVCSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAA
LAPTPGKPHRVCDACYTKLKAGESGYNSNVANRNSTTPTRSLDGTGRPDRDIRSSRILLS
PKTEPVKYSEVRSSRSESSIVRASQVPALQQLRDVAFPSSLSAIQNAFKPVASSSTSTLP
SGTRSSRISSPPRSSGFSRGMIDTLKKSNGVINKEMTKLQSQIKNLKEKCDNQGTEIQRL
KKTAREASDLAVKHSSKHKAATEVMKSVAEHLRELKEKLPPEVSRCEAFESMNSQAEAYL
NASEASESCLPTTSLGMGQRDPTPSTNTQDQNIEEKQSSNGGNMRSQEPSGTTEASSSSK
GGGKELIEQFEPGVYVTYVLHKNGGKIFRRVRFSFFVANGDLMSIKQKNGGIAKKIGCLR
GIVIMLHHRVQRLLIQFQHQLNLNHQLLIQFLHQLNLNHQLLIQFLHQLNLNHQLLLHNR
ILIKQRIQKKFLMKASHHVYNSSLAK
Download sequence
Identical sequences F4JVE8
AT4G14368.1 AT4G14368.1 NP_001154232.2.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]