SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G17140.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G17140.1
Domain Number 1 Region: 797-902
Classification Level Classification E-value
Superfamily PH domain-like 0.00000231
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Weak hits

Sequence:  AT4G17140.1
Domain Number - Region: 2648-2691
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0851
Family PLC-like (P variant) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT4G17140.1
Sequence length 4216
Sequence
MLEDQVAYLLQRYLGNYVRGLNKEALKISVWQGDVELKNMQLKPEALNALKLPVRVKAGF
LGSVKLKVPWTRLGQEPVVVYLDRIFVLAEPATDVEGLSEDSIQEAKRNLIREMETKLVE
RARRLQTEMNKSWMGSVINTIVGNLKLSISNIHIRYEDLESNPGHPFSAGVTLEKLSAVT
IDESGKETFITGGTLDSIQKSVELDRLAFYLDSDMSPWHIDKPWEVLTPFEWDQIFRYGT
KDGKPADCLTRKHFYILQPVSGNAKYSKSQANESSNAVQPLQKAYVNLDDVTLCLSKGGY
RDVMKLADNFAAFNQRLKYAHYRPSVPVKIDAKSWWKYAYRVVSEQIKIASGRMSWEHVL
KYTSLRKRYITQYASLLKSDISRIVVDDDEEIEALDRELDTDVILQWRMLAHKFVERSVQ
AENYSKKQQAKSSWWPFGGKSEVSGGEGESIQFTDEDWERLNKVIGYKEGDEQSIINNAK
PDALHTFLEVQMKRSASKLYDGEKECLAELSCEGLNCSVKLFPETKIADIKLGRYRLSSP
SGLLAESAPASHSVLAVFCYKPFDAKVDWSLVAKASPCYMTYLKDSIDGIVNFFESSTAV
SQTIALETAAAVQSTIDEVRRTAQEGMNRALKDHSRFLLDLDIAAPKITIPTEFRPDNHR
STKLLLDLGNLVIRSQDDYKHELTEEMDMYLQFDLVLSDVSALLVDGDYSWKQLSSKRAS
SSGRESSVTFLPVIDKCGVLLKLQQIRRPNPAYPSTRLAVRLPSLGFHFSPARYHRLMQV
AQIFQTKDDESSQILRPWEEADFEGWLSILSWKGREASWQRRYLCLVGPFIYVLESPGSK
SYKKYTSLRGKHIYKVPVELAGGVEHVLSIRNASRISEKGLRSHSDDYSRKTWHSRLQGA
VYRASGVYCETVPLTGSAPIAGLSDTSSDSEESETEQKDGFDLSNLESVYVTGVLDELKI
CFSYGHQDDASFMAVLLARESKLFEFRALGGKVEVSMRGSDMFIGTVLKSLEIEDLVSHS
GLNESCYLARSFIQSSEMLPSFEDAESRSPERLDPTSSEGEEKFYEAPEILVDSIDYTSL
RTPSFSRIDGLLPVDNKNITKPSNETTESLDSFVKAQIVIYHQTSPQYKNIDNQVMVTLA
TLSFFCRRPTILAILEFVNAINVEDPSCESFEDNSPVAGEHTSPRRDGFEDSRDAAVKGL
LGKGKSRIIFNLELNMARAQIFLMNENGTKFATLSQDNLLTDIKVFPNSFSIKASLGNLR
ISDDSLPDNHMYFWICDMRDPGGTSFVELVFTSFSIIDEDYEGFDYCLSGQFSEVRIVYL
NRFIQEVAEYFMGLVPSDSKGVVKMKDQITDSEKWFTTSEIEGSPALKLDLSLKKPIIVM
PRHTDSPDYLKLDIVHITVDNTFQWFAGDKNELNAVHVETMKIMVMDINLNVGSGAEIGE
SIIQDVKGVSVTINRSLRDLLHQIPSIEVSIEIDELRAALSNREYQILTECAQSNISELP
HAVPPLSGDVVTSSRNLHETLTSEDTNAAQTEKTDTWISMKVSVVINLVELCLYAGTARD
TPLAAVQISGGWLLYKSNTHDEGFLTATLKGFSVIDNREGTEKEFRLAVGRPADLDFGDS
HSVTDKNQGLTQSHVTTGSDIGPFPSMLTLDAQFGQLSTFVSVSIQRPQLLVALDFLLAV
VEFFVPTIGSVLSSEEDKNLNMVDAIVMDKSIYKQQTAEAFLSPLGPLIAEDEKFDNFVY
DGNGGTLYLKDRNGGILSSPSIEPIIYVGSGKRLQFRNVVFKNGQVLDSCISLGACSSYS
VSREDGVELEVYHKAPQQDSERKEDPVSQSPSTTTERSTEMIIEFQAIGPELTFYNTSKD
VVKTPLLSNKLLHAQLDAYGRVVIKNDEIKMSAHTLGLTMESNGVKILEPFDTFVKYSSV
SGKTNIRLSVSNIFMNFSFSILRLFIAVEEDILSFLRMTSRKMTVVCSEFDKIGTIRNPC
TDQIYAFWRPHPPPGFASLGDYLTPLDKPPTKGVLVVNTNLMRVKRPLSFKLIWSPLASG
GLGGSSMDDKDERDSSCSIWFPEAPKGYVALSCVVSSGSTPPSLASTFCILASSVSPCSL
RDCVAISSTDISQSSLAFWRVDNSVGSFLPADPSTLNLLGRPYELRHILFGSTAVLPKES
SYVDDRTTPDDIIQPTRPQPLNSVNSGHRFEAVATFELIWWNRGSGSQKKVSIWRPIVSE
GMAYFGDIAVSGYEPPNSCVVLHDTSDQEILKAAVDFQLVGRVKKHRGVESISFWMPQAP
PGFVSLGCVACKGSPKPYDFTKLRCARSDMVAGDHFADESLWDTSDVWQRVEPFSIWSIG
NELKTFIVRSGLKKPPRRFALKLADQGLPGGTDNMVIHAEIGTFSAALFDDYGGLMVPLV
NVSLNNISFGLLGKTDYTNSTINFSLAARSYNDKYEAWEPLIEPADGFLRYQFNPRSFGA
VSQLRLTSTKDLNVNISVSNANTIIQAYSSWNSLSNVHGYHKERGALPLVDNGKSVIEVH
QKKNYFIIPQNKLGQDIYIRATEIKGFKDIVKMPSGDVRPVKVPVLTNMLDSHLRGELCR
NPRIMVTVIVMDAQLPRTCGLSSHQYTGVIRLSPNQTSPVESELRQQSARTCGSVSNMLS
SELEVVDWNEIFFFRIDSLDDFVLELIVTDVGKGAPVGSFSAPLKQIAQYMKDNVYQHNY
ANDLVWLDLSTTETMSINQGDQRKNCGKIRCAVLLPAKSKVDQSKSFREKKSGFLQVSPS
IEGPWTTVRLNYAAPAACWRLGNDVVASEVSMQDGNRYVNVRSLVSVENNTDFLLDLCLQ
SKVNSIPDIPIGLLKPGDTLPVPLSGLTQSASYVLKLKCVFPDGSDEYSWSSVVSRPGGA
EVSCESEPEICISALTESEHLLFCTQINSTSSGDNQKLWFCLKTQATEIAKDIRSDPIQD
WTLVVKSPFSIANCLPFGAEYSVLEAQASGHFICRCRGVFISGETVKVYSVDIRNPLYFS
LLPQRGWLPMHEAVLISHPNGVPAKTIGLRSSATGRIAQVILEQNYDEQQIVLSKIIRVY
APFWFSIARCPSLTLRLLDLSGKKQTRKVGLPFRSKKNDEVVLDEVTEEEIYEGHTIAST
LNFKLLGLSVSISQFGNQQHGPVKDLSALGDMDGSLDVDAYDPDGNCMRLFLSTKPCAYQ
SVPTKMNQKYSMLMIQGSPLFSSQVGEMNSRERHKNKRMVKNVVEGVHWKYVAYDICSVK
PVRLLGAVRLRETEWSFPVQVTREDTIVLVLKSKNGARRYVKAEIRGFEEGSRFIVVFRL
GPSNGPMRVENRSTVKSISVRQSGFGEDSWVLLEPLTTENFAWEDPYGQKFLDAKVESDH
RSGVFKVDMEKGAVDSELCRELEVNFDVQEIGDIKIARFTDDDSTSQSSNEIISLTSIGN
HGYSTPQTPTEHKTTTLEVIIEMGLVGISLVDHMPKELSYFYLERVFVSYSTGYDEGRTS
RFKIILGRLQIDNQLPLTLMPVLLAPDNTGDSRQPVLKMTITMCNEETDGIQVYPYVYVR
VTDNTWRLNIHEPIIWASADFYNKLQMDRLPKSSSVAQVDPEIHINLIDVSEVRLKVSLE
TAPAQRPHGILGVWSPILSAVGNAFKIQVHLRRVMHRDRFIRKSSILPAIGNRIWRDLIH
NPLHLIFSVDVLGMTSSTLASLSKGFAELSTDGQFMQLRAKQVWSRRITGVGDAIVQGTE
ALAQGVAFGVSGVVTKPVESARENGILGFAHGVGRAFLGFIVQPVSGALDFFSLTVDGIG
ASCSRCLEVLSNRTALERIRNPRAVHADGILREYDEKEAIGQMLLHLAEASRHFGCTEIF
REPSKFALSDCYEEHFLVPYKRIVMVTNKRVVLLQCSDLDKMDKKPSKIMWDVPWEELMA
LELAKAGSQRPSHLILHLKSFRKSESFAQVIKCSVPEDLNGLEPQAVRICSVVRKMWKAY
QSNMKNLVLKVPSSQRHVYFAWNEADGRDSKTYKNKAIIKSRELSSSSSVSDDKKLVKHS
INFSKIWSSERESKGRCSLCKKQDSEDGGVCTIWRPSCPAGFVSVGDVAHVGSHPPNVAA
VYNNTNGVFALPVGYDLVWRNCLDDYISPVSIWHPRAPEGFVSPGCVAVAGFIEPELNTV
YCMPTSLAEQTEFEEQKVWSAPDSYPWACQIYQVRSDALHFMALRQTKEDSDWKAIRVRD
DYRSIESESGKNLRLE
Download sequence
Identical sequences F4JNE4
NP_193447.5.80155 AT4G17140.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]