SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G17140.3 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G17140.3
Domain Number 1 Region: 793-926
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000695
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Weak hits

Sequence:  AT4G17140.3
Domain Number - Region: 2674-2717
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0851
Family PLC-like (P variant) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT4G17140.3
Sequence length 4219
Sequence
MLEDQVAYLLQRYLGNYVRGLNKEALKISVWQGDVELKNMQLKPEALNALKLPVRVKAGF
LGSVKLKVPWTRLGQEPVVVYLDRIFVLAEPATDVEGLSEDSIQEAKRNLIREMETKLVE
RARRLQTEMNKSWMGSVINTIVGNLKLSISNIHIRYEDLESNPGHPFSAGVTLEKLSAVT
IDESGKETFITGGTLDSIQKSVELDRLAFYLDSDMSPWHIDKPWEVLTPFEWDQIFRYGT
KDGKPADCLTRKHFYILQPVSGNAKYSKSQANESSNAVQPLQKAYVNLDDVTLCLSKGGY
RDVMKLADNFAAFNQRLKYAHYRPSVPVKIDAKSWWKYAYRVVSEQIKIASGRMSWEHVL
KYTSLRKRYITQYASLLKSDISRIVVDDDEEIEALDRELDTDVILQWRMLAHKFVERSVQ
AENYSKKQQAKSSWWPFGGKSEVSGGEGESIQFTDEDWERLNKVIGYKEGDEQSIINNAK
PDALHTFLEVQMKRSASKLYDGEKECLAELSCEGLNCSVKLFPETKIADIKLGRYRLSSP
SGLLAESAPASHSVLAVFCYKPFDAKVDWSLVAKASPCYMTYLKDSIDGIVNFFESSTAV
SQTIALETAAAVQSTIDEVRRTAQEGMNRALKDHSRFLLDLDIAAPKITIPTEFRPDNHR
STKLLLDLGNLVIRSQDDYKHELTEEMDMYLQFDLVLSDVSALLVDGDYSWKQLSSKRAS
SSGRESSVTFLPVIDKCGVLLKLQQIRRPNPAYPSTRLAVRLPSLGFHFSPARYHRLMQV
AQIFQTKDDESSQILRPWEEADFEGWLSILSWKGREASWQRRYLCLVGPFIYVLESPGSK
SYKKYTSLRGKHIYKVPVELAGGVEHVLSIRNASRISEKVMEDVNALILMFDSEDSRKTW
HSRLQGAVYRASGSAPIAGLSDTSSDSEESETEQKDGFDLSNLESVYVTGVLDELKICFS
YGHQDDASFMAVLLARESKLFEFRALGGKVEVSMRGSDMFIGTVLKSLEIEDLVSHSGLN
ESCYLARSFIQSSEMLPSFEDAESRSPERLDPTSSEGEEKFYEAPEILVDSIDYTSLRTP
SFSRIDGLLPVDNKNITKPSNETTESLDSFVKAQIVIYHQTSPQYKNIDNQVMVTLATLS
FFCRRPTILAILEFVNAINVEDPSCESFEDNSPVAGEHTSPRRDGFEDSRDAAVKGLLGK
GKSRIIFNLELNMARAQIFLMNENGTKFATLSQDNLLTDIKVFPNSFSIKASLGNLRISD
DSLPDNHMYFWICDMRDPGGTSFVELVFTSFSIIDEDYEGFDYCLSGQFSEVRIVYLNRF
IQEVAEYFMGLVPSDSKGVVKMKDQITDSEKWFTTSEIEGSPALKLDLSLKKPIIVMPRH
TDSPDYLKLDIVHITVDNTFQWFAGDKNELNAVHVETMKIMVMDINLNVGSGAEIGESII
QDVKGVSVTINRSLRDLLHQIPSIEVSIEIDELRAALSNREYQILTECAQSNISELPHAV
PPLSGDVVTSSRNLHETLTSEDTNAAQTEKTDTWISMKVSVVINLVELCLYAGTARDTPL
AAVQFFLEESRGHVIVLMGPYIFSISLAPFSVLISGGWLLYKSNTHDEGFLTATLKGFSV
IDNREGTEKEFRLAVGRPADLDFGDSHSVTDKNQGLTQSHVTTGSDIGPFPSMLTLDAQF
GQLSTFVSVSIQRPQLLVALDFLLAVVEFFVPTIGSVLSSEEDKNLNMVDAIVMDKSIYK
QQTAEAFLSPLGPLIAEDEKFDNFVYDGNGGTLYLKDRNGGILSSPSIEPIIYVGSGKRL
QFRNVVFKNGQVLDSCISLGACSSYSVSREDGVELEVYHKAPQQDSERKEDPVSQSPSTT
TERSTEMIIEFQAIGPELTFYNTSKDVVKTPLLSNKLLHAQLDAYGRVVIKNDEIKMSAH
TLGLTMESNGVKILEPFDTFVKYSSVSGKTNIRLSVSNIFMNFSFSILRLFIAVEEDILS
FLRMTSRKMTVVCSEFDKIGTIRNPCTDQIYAFWRPHPPPGFASLGDYLTPLDKPPTKGV
LVVNTNLMRVKRPLSFKLIWSPLASGGLGGSSMDDKDERDSSCSIWFPEAPKGYVALSCV
VSSGSTPPSLASTFCILASSVSPCSLRDCVAISSTDISQSSLAFWRVDNSVGSFLPADPS
TLNLLGRPYELRHILFGSTAVLPKESSYVDDRTTPDDIIQPTRPQPLNSVNSGHRFEAVA
TFELIWWNRGSGSQKKVSIWRPIVSEGMAYFGDIAVSGYEPPNSCVVLHDTSDQEILKAA
VDFQLVGRVKKHRGVESISFWMPQAPPGFVSLGCVACKGSPKPYDFTKLRCARSDMVAGD
HFADESLWDTSDVWQRVEPFSIWSIGNELKTFIVRSGLKKPPRRFALKLADQGLPGGTDN
MVIHAEIGTFSAALFDDYGGLMVPLVNVSLNNISFGLLGKTDYTNSTINFSLAARSYNDK
YEAWEPLIEPADGFLRYQFNPRSFGAVSQLRLTSTKDLNVNISVSNANTIIQAYSSWNSL
SNVHGYHKERGALPLVDNGKSVIEVHQKKNYFIIPQNKLGQDIYIRATEIKGFKDIVKMP
SGDVRPVKVPVLTNMLDSHLRGELCRNPRIMVTVIVMDAQLPRTCGLSSHQYTGVIRLSP
NQTSPVESELRQQSARTCGSVSNMLSSELEVVDWNEIFFFRIDSLDDFVLELIVTDVGKG
APVGSFSAPLKQIAQYMKDNVYQHNYANDLVWLDLSTTETMSINQGDQRKNCGKIRCAVL
LPAKSKVDQSKSFREKKSGFLQVSPSIEGPWTTVRLNYAAPAACWRLGNDVVASEVSMQD
GNRYVNVRSLVSVENNTDFLLDLCLQSKVNSIPDIPIGLLKPGDTLPVPLSGLTQSASYV
LKLKCVFPDGSDEYSWSSVVSRPGGAEVSCESEPEICISALTESEHLLFCTQINSTSSGD
NQKLWFCLKTQATEIAKDIRSDPIQDWTLVVKSPFSIANCLPFGAEYSVLEAQASGHFIC
RCRGVFISGETVKVYSVDIRNPLYFSLLPQRGWLPMHEAVLISHPNGVPAKTIGLRSSAT
GRIAQVILEQNYDEQQIVLSKIIRVYAPFWFSIARCPSLTLRLLDLSGKKQTRKVGLPFR
SKKNDEVVLDEVTEEEIYEGHTIASTLNFKLLGLSVSISQFGNQQHGPVKDLSALGDMDG
SLDVDAYDPDGNCMRLFLSTKPCAYQSVPTKVTSILSSTFSLLLHEPKVLHAYDSRVSFV
FQPSGRDELQVRLRETEWSFPVQVTREDTIVLVLKSKNGARRYVKAEIRGFEEGSRFIVV
FRLGPSNGPMRVENRSTVKSISVRQSGFGEDSWVLLEPLTTENFAWEDPYGQKFLDAKVE
SDHRSGVFKVDMEKGAVDSELCRELEVNFDVQEIGDIKIARFTDDDSTSQSSNEIISLTS
IGNHGYSTPQTPTEHKTTTLEVIIEMGLVGISLVDHMPKELSYFYLERVFVSYSTGYDEG
RTSRFKIILGRLQIDNQLPLTLMPVLLAPDNTGDSRQPVLKMTITMCNEETDGIQVYPYV
YVRVTDNTWRLNIHEPIIWASADFYNKLQMDRLPKSSSVAQVDPEIHINLIDVSEVRLKV
SLETAPAQRPHGILGVWSPILSAVGNAFKIQVHLRRVMHRDRFIRKSSILPAIGNRIWRD
LIHNPLHLIFSVDVLGMTSSTLASLSKGFAELSTDGQFMQLRAKQVWSRRITGVGDAIVQ
GTEALAQGVAFGVSGVVTKPVESARENGILGFAHGVGRAFLGFIVQPVSGALDFFSLTVD
GIGASCSRCLEVLSNRTALERIRNPRAVHADGILREYDEKEAIGQMLLHLAEASRHFGCT
EIFREPSKFALSDCYEEHFLVPYKRIVMVTNKRVVLLQCSDLDKMDKKPSKIMWDVPWEE
LMALELAKAGSQRPSHLILHLKSFRKSESFAQVIKCSVPEDLNGLEPQAVRICSVVRKMW
KAYQSNMKNLVLKVPSSQRHVYFAWNEADGRDSKTYKNKAIIKSRELSSSSSVSDDKKLV
KHSINFSKIWSSERESKGRCSLCKKQDSEDGGVCTIWRPSCPAGFVSVGDVAHVGSHPPN
VAAVYNNTNGVFALPVGYDLVWRNCLDDYISPVSIWHPRAPEGFVSPGCVAVAGFIEPEL
NTVYCMPTSLAEQTEFEEQKVWSAPDSYPWACQIYQVRSDALHFMALRQTKEDSDWKAIR
VRDDYRSIESESGKNLRLE
Download sequence
Identical sequences F4JNE2
AT4G17140.3 NP_001190747.1.80155 AT4G17140.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]