SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G17350.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AT4G17350.1
Domain Number - Region: 276-382
Classification Level Classification E-value
Superfamily PH domain-like 0.0082
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT4G17350.1
Sequence length 405
Sequence
MESGFYSDWKDTSSSSFFGSENMEEELEDGVLRAEELFSSIPQPQTPKEPMEFLSRSWSL
STSEISKALALKHRQQQDQFCVGQNSPPVLFPDAAADPLVAGKIMNSVGTRRAGTLSKWF
HHNKEHSTSSTTTNLKKKDKVRVENAHVHSAVSIAALAAGLASVTSASNCKGSGSKMALA
LASATELLASHCVEMAERAGADHARVTSTVRSSVDIHSPGDLMTLTAAAATALRGEAALK
ARQPKEARKNAAITPFERSFSDSHWHANFQYRLEEPNLPFEGELMQCARNGVQRTKRVCV
YINKKSQVMIKLKSKHVGGAFSKKIKCVVYGVCDEKSAWPYRKERENSEEVYFGLKTGQG
LLEFKCKSKIHKQRWVDGVQSLLRQVNCFEAAKCSLGSLNLTGHT
Download sequence
Identical sequences Q5U1F1
3702.AT4G17350.1-P AT4G17350.1 NP_193466.2.80155 AT4G17350.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]