SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G18740.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AT4G18740.2
Domain Number - Region: 184-211
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00255
Family Rho termination factor, N-terminal domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT4G18740.2
Sequence length 214
Sequence
MDLALHCHCAYPLIKLGFMRAKSANHLHVRDTHSLPFALRFEQSLSRTTINGDRSIWFQE
KGGSSYTSMGRSKKGCVCCKKPSDRRTSNPSKSNQEEIISLLKRIQSSISKGESRGVEEE
KNSDESSKEKPLTKAILDVLEKSRKKTEGDTSVKEKPPKRQVELPRPPSSFVKRTPLSSS
ASGPRELKEVAKNRGIKGYSKLRKSELLELIRSS
Download sequence
Identical sequences A0JQ06
AT4G18740.2 NP_974569.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]