SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G18740.3 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AT4G18740.3
Domain Number - Region: 159-186
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00208
Family Rho termination factor, N-terminal domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT4G18740.3
Sequence length 189
Sequence
MFEIADTHSLPFALRFEQSLSRTTINGDRSIWFQEKGGSSYTSMGRSKKGCVCCKKPSDR
RTSNPSKSNQEEIISLLKRIQSSISKGESRGVEEEKNSDESSKEKPLTKAILDVLEKSRK
KTEGDTSVKEKPPKRQVELPRPPSSFVKRTPLSSSASGPRELKEVAKNRGIKGYSKLRKS
ELLELIRSS
Download sequence
Identical sequences F4JRN1
NP_001190763.1.80155 AT4G18740.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]