SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G19040.3 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G19040.3
Domain Number 1 Region: 185-361
Classification Level Classification E-value
Superfamily Bet v1-like 6.32e-42
Family STAR domain 0.0071
Further Details:      
 
Domain Number 2 Region: 1-114
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000308
Family Pleckstrin-homology domain (PH domain) 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT4G19040.3
Sequence length 720
Sequence
MSKVVYEGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKPQDYQVPIKTMLIDGNCRV
EDRGLKTHHGHMVYVLSVYNKKEKSHRITMAAFNIQEALMWKEKIESVIDQHQESQVPNG
QQYVSFEYKSGMDTGRTASSSDHESQFSAAEDEEDSRRSLMRRTTIGNGPPESVLDWTKE
FDAELANQNSDNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEATCE
EIFELLMSMDGTRYEWDCSFQFGSLVEEVDGHTAVLYHRLLLDWIVWPRDLCYVRYWRRN
DDGSYVVLFRSREHENCGPQPGCVRAHLESGGYNISPLKPRNGRPRTQVQHLIQIDLKGW
GAGYLPAFQQHCLLQMLNSVAGLREWFSQTDERGVHTRIPVMVNMASSSLSLTKSGKSLH
KSAFSLDQTNSVNRNSLLMDEDSDDDDEFQIAESEQEPETSKPETDVKRPGVHPIKEEPA
HNIDLSCFSGNLKRNENENARNCWRISDGNNFKVRGKNFGQEKRKIPAGKHLMDLVAVDW
FKDSKRIDHVARRKGCAAQVAAEKGLFSMVVNVQVPGSTHYSMVFYFVMKELVPGSLLQR
FVDGDDEFRNSRLKLIPLVPKGSWIVRQSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGS
STVANGVLGLVIGVITSLVVEMAFLVQANTAEEQPERLIGAVRVSHIELSSAIVPNLESE
Download sequence
Identical sequences AT4G19040.3 NP_001190769.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]