SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G22140.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G22140.2
Domain Number 1 Region: 140-197
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.66e-19
Family PHD domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT4G22140.2
Sequence length 224
Sequence
MAKTRPGVASKIKTGRKELDSYTIKGTNKVVRAGDCVLMRPSDAGKPPYVARVEKIEADA
RNNVKVHCRWYYRPEESLGGRRQFHGAKELFLSDHFDVQSAHTIEGKCIVHTFKNYTRLE
NVGAEDYYCRFEYKAATGAFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWYHPACVGMTI
EEAKKLDHFVCAECSSDDDVKKSQNGFTSSPADDVKVETKRRKR
Download sequence
Identical sequences A0A178UYA0
NP_001031695.1.80155 AT4G22140.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]