SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G22540.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G22540.1
Domain Number 1 Region: 339-714
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 5.49e-114
Family Oxysterol-binding protein 0.001
Further Details:      
 
Domain Number 2 Region: 52-83,119-173
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-16
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT4G22540.1
Sequence length 721
Sequence
MRVKELHPLCCITLESPHGINSQSPEEPVTTALTRSRSLPAKSLTGGSESETVAGILYKW
TNFGKGWRSRWFLLRNGILSYSKIRRPENLNLLSPDDDVRLIGDISGERLSRMDSCSGRR
KQQKTVGIVHLKVSSFRESKSDDRKFYIFTATKTLHLRTDSITDRAAWLQALASTKCIFP
LRSLNGDFSFIPPKDLSISTERLKKRLHEEGMNENLVKECEQIMLSEFSEMHGQVKLLHE
ERTNLLDALRQLEAANLEVGASGKHEFSSLGRGKYSECSTTASSDGKQEFEDVSEEDEPS
FHDTKEFFNEPNIGSESNLAISGHTDIKRRTKLPDPAEKEKGVSLWSMIKDNVGKDLTRV
CLPVYFNEPISSLQKCFEDLEYSYLLDRAYEHGKSGNGLLRALNVAAFAVSGYASTEGRH
CKPFNPLLGETYEADFPEKGIRFFSEKVSHHPTVIACHCEGKGWKFWGDTNLRSKFWGRS
IQVEPVGVLTLEFDDGEVFQWSKVTSTIYNIILGKLYCDHHGVMQIRGNRQYSCTLKFKE
QSILERNPHQVNGFVEDVAGQKAATIFGKWDDSLYYVAGDGINKSKVSDPASNASLLWKR
TKPPPNVTRYNLTSFAITLNELTPGLQEILPPTDSRLRPDQRHLENGEYEKANLEKQRLE
RRQRMSRQLQESGWRPRWFERQGESDTFKYTGGYWEARGHRNWDDCPDIFGEFTEELADA
A
Download sequence
Identical sequences A0A178UYT2 Q940Y1
AT4G22540.1 3702.AT4G22540.1-P NP_001328217.1.80155 NP_567662.1.80155 AT4G22540.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]