SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G24580.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G24580.1
Domain Number 1 Region: 221-414
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.59e-33
Family BCR-homology GTPase activation domain (BH-domain) 0.0017
Further Details:      
 
Domain Number 2 Region: 18-166
Classification Level Classification E-value
Superfamily PH domain-like 8.84e-18
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT4G24580.1
Sequence length 933
Sequence
MANKNAESSSQPPPHVQPNQQQQQQPPIANEQEQEPHGDTCSIPPAQSGNTDSRSRGGNT
VFKSGPLSISSKGIGWTSWKKRWFILTRTSLVFFRSDPSAVQQKGSEVNLTLGGIDLNNS
GSVVVKADKKLLTVLFPDGRDGRAFTLKADTMEDLHEWKAALENALTQAPSASHVMGQNG
IFRNDHADPAVGVDEKKDETPTKSTVLGRPVLLALEDVDGAPSFLEKALRFVENHGVRIE
GILRQAADVDDVEHRIREYEKGKNEFSPEEDAHIIADCLKYFLRELPSSPVPASCCNALL
EACRTDRGNRVNAMRAAICESFPEPNRRLLQRILMMMQTVASNKTVNRMNTNAVAACMAP
LLLRPLLAGDCEIENDFDVGGDGSMQLLQAAAAANHAQAIVITLLEEYESIFGTLTSSII
NGLCLQEGSLSPGLYSDSEESGSGTEEGSDDEEYDDDDDGSQGSEDYTDEEEDLENESNG
SYSESAASEDKYADSIDPDDHKINDNLSTESKSPKRSKEPKKLLSGSRRSSLPRHDDGKK
DEDIVVKGVNNTEVKAVVEVSTSEDKNSSTSDVASDTQKPSKLSDAPGGSKRHWGRTPGK
KNLSMESIDFSVEVDEDNADIERLESTKLELQSRITEEVKSNAVLQASLERRKKALYGRR
QALEQDVGRLQEQLQQERDRKLALETGLNMSKGNQPIPETIDENLKKDLQEVAQAEADIA
KLEHKVDDLENRLGHHDGKASGSTHSASKESRKLPEHNAKMKEKQKDTEAASTHISERST
SKDGQGAARENETEKQQDSRSKSSQQETSRGSSKLVGLSKRSGTKGEGSTTTTSALSKLT
MRLNFLKERRSQIANELQNMDKGKTLGQPSPTSGQNRVSEETEKGSGSNQDPDSSKLQSP
HILDRGRSENGGDRGRGSSGGNHPNTTPRTFSR
Download sequence
Identical sequences AT4G24580.1 AT4G24580.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]