SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G29110.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AT4G29110.1
Domain Number - Region: 90-122
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0981
Family GCC-box binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT4G29110.1
Sequence length 200
Sequence
MESSVPKRGLYMEMEQNAQVAAKRLWKVVRIVFCVLKTGTVKNKLMLDLNLMLKRGNKAI
TNLRRRSSSTGSHDVSSSSRVRDYDPFAFISKRKRRVHGGYDNEEDAVEAAVKKVFELLG
ENDKKTVATESARESPLIMSPAVRQLRVTDSPFPLDDGGDHDHVVDKAAEEFIKKFYKNL
KLQKKMTNALESPYHDGWVR
Download sequence
Identical sequences A0A178V0H4 Q9SZE0
3702.AT4G29110.1-P AT4G29110.1 AT4G29110.1 NP_194640.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]