SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G30860.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G30860.1
Domain Number 1 Region: 261-462
Classification Level Classification E-value
Superfamily SET domain 5.05e-60
Family Histone lysine methyltransferases 0.00093
Further Details:      
 
Weak hits

Sequence:  AT4G30860.1
Domain Number - Region: 119-165
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000748
Family PHD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT4G30860.1
Sequence length 497
Sequence
MLDLGNMSMSASVALTCCPSFLPAASGPELAKSINSPENLAGECNGKHLPMIPPEEEVKD
IKIANGVTAFTRKQNPSDRVKKGFVLDDHVKDWVKRRVASGVSESTCFLPFLVGAKKMVD
CLVCHKPVYPGEDLSCSVRGCQGAYHSLCAKESLGFSKSSKFKCPQHECFVCKQRTQWRC
VKCPMAAHDKHSPWSKEILHLKDQPGRAVCWRHPTDWRLDTKHAVAQSEIEEVFCQLPLP
YVEEEFKIDLAWKDSVVKEDPPSYVHIRRNIYLVKKKRDNANDGVGCTNCGPNCDRSCVC
RVQCISCSKGCSCPESCGNRPFRKEKKIKIVKTEHCGWGVEAAESINKEDFIVEYIGEVI
SDAQCEQRLWDMKHKGMKDFYMCEIQKDFTIDATFKGNASRFLNHSCNPNCVLEKWQVEG
ETRVGVFAARQIEAGEPLTYDYRFVQFGPEVKCNCGSENCQGYLGTKRKEPNCLVVSWGA
KRRRLFHRPIARKPQQD
Download sequence
Identical sequences A0A178UX33 Q949T8
NP_567859.1.80155 AT4G30860.1 AT4G30860.1 3702.AT4G30860.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]