SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G31650.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G31650.1
Domain Number 1 Region: 9-107
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.22e-20
Family B3 DNA binding domain 0.0046
Further Details:      
 
Domain Number 2 Region: 125-225
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-19
Family B3 DNA binding domain 0.0062
Further Details:      
 
Domain Number 3 Region: 387-488
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-17
Family B3 DNA binding domain 0.014
Further Details:      
 
Domain Number 4 Region: 297-375
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.51e-17
Family B3 DNA binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT4G31650.1
Sequence length 493
Sequence
MNNPTLFSPKSPHFFQPLLPGFKSHINIPVKFFSKYIKGKHEGKTVKLRSDSSKRTWKVK
IEGHTLTDGWKEFVEAHDLRISDFVIFKHKGDMFFDVTALGSSCWESSRKEKEIEENIET
EPDQFSSDLTCFSQSVTTSNLMRDSVGVPRDFAKRYGFNIGRHEIVLMNEEGKPWESEVI
SYKSGKVIVAGGWKSLCTESKLEVGDSCTFKLLHNAKMPVFRLCSKLPKAGAEARPLKRA
RVQRWSQESRSKHDVREKIAEEGEPSRRNRTSNKSTGDQGKLQQTQSCFIFDHVAKSLPR
NFVRSDGLIKGSNKIVLMNEGARTWTLILKFRDSRRSFYSRGGWRSFCRENGLKPGDSVT
FKLESSNTKTPLLLFSIAESKSASTKDRTRFLTLTVTPSSIRSSRLYLSKKFISVNKMER
AGGKKITLLDKNGEEWPVTLLMDKRYTRMVLGSGLREFCNAIGVKAYESVVLELVWEETT
TLPMFKFCSKIKT
Download sequence
Identical sequences O81782
AT4G31650.1 AT4G31650.1 NP_194893.1.80155 3702.AT4G31650.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]