SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G31690.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G31690.1
Domain Number 1 Region: 9-110
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-24
Family B3 DNA binding domain 0.0021
Further Details:      
 
Domain Number 2 Region: 142-241
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.83e-21
Family B3 DNA binding domain 0.0048
Further Details:      
 
Domain Number 3 Region: 246-321
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000981
Family B3 DNA binding domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT4G31690.1
Sequence length 461
Sequence
MANASPLSPTNQHFFQPLLPGFQSNLKIPVNYFSEHIEGKHEGKTVTLRTDASERTWEVK
MEGHRLTEGWKEFVEAHDLRIGDFVVFRHEGDMVFHVTALGPSCCEIQYPQSSRHEEGEE
SGENEISEKEGEENVQKESDKSSSDLNCFSQSVTHSNISRDAVSVPRDFVKRSGFSKGRH
EIVLMNEEGKSWESEVKSYMSGAVYLVGGWTTFCTENKLDVGDSCTFKLLQKAKTPVFQL
CSRTKHLPLSFTKVNGLINPGKIILVDKDRAEWSMMLKVDSRGAVYIIGGNDWKSFCAAN
EVGAGESLALELIQGGVLLNQITTCFQMEQPSFKAEDGRHKRARVQNRSQETDKGAETSR
ASTMGPKLEITEKGEPSRASTMRPKVEIREKIAETGEPSRASNKSSGIEGNLQHTKPCSV
KTDQLAKVKESVVDTLTSIGRFQAELETMKRKLEDSLQELN
Download sequence
Identical sequences O81778
AT4G31690.1 AT4G31690.1 3702.AT4G31690.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]