SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G33240.3 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G33240.3
Domain Number 1 Region: 1446-1715
Classification Level Classification E-value
Superfamily SAICAR synthase-like 2.94e-78
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00041
Further Details:      
 
Domain Number 2 Region: 440-612
Classification Level Classification E-value
Superfamily GroEL apical domain-like 5.49e-43
Family Group II chaperonin (CCT, TRIC), apical domain 0.00028
Further Details:      
 
Domain Number 3 Region: 31-102
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.54e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0023
Further Details:      
 
Weak hits

Sequence:  AT4G33240.3
Domain Number - Region: 396-446,605-632
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.000519
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT4G33240.3
Sequence length 1753
Sequence
MDSQDHKAPGFVDIVKSWIPRKSESSNMSRDFWMPDQSCPVCYECDAQFTVFNRRHHCRL
CGRVFCAKCAANSIPSPSDETKDSHEEPERIRVCNYCYKQWEQGIVPPDNGASIISLHFS
SSPSARSVASTTSNSSNCTIDSTAGPSPRPKMNPRASRRVSSNMDSEKSEQQNAKSRRSS
DHYGHVLDSSDNQVEFFVNSSGRSDGEADDDDDYQSDFAQSYAQGNDYYGAINLDEVDHI
YGSHEAHDVGVKIEPNISGFPPDQDLDSLNTETIDKTRQQENGWNDVKEGSPPCEESFEP
EVVDFESDGLLWLPPEPENEEDEREAVLSDDDGDEGDRGDWGYLRPSNSFNEKDFHSKDK
SSGAMKNVVEGHFRALVAQLLEVDNLPMVNEGDEEGWLDIITSLSWEAATLLKPDTSKSG
GMDPGGYVKVKCIPCGRRSESMVVKGVVCKKNVAHRRMTSKIEKPRLLILGGALEYQRIS
NQLSSFDTLLQQEMDHLKMAVAKIDSHNPDILLVEKSVSRFAQEYLLAKDISLVLNIKRS
LLERISRCTGAQIVPSIDQLTSPKLGYCDLFHVEKFVETHVSPCQVAKKMAKTLMFFDGC
PKPLGCTILLKGAHEDELKKVKHVIQYGVFAAYHLALETSFLADEGASIHELPLQTPITV
ALPDKPSMVNRSISTIPGFTVSSAEKSPTTELRGEPHKANGDLTGNFTSSKTHFQGKLDG
NDRIDPSERLLHNLDTVYCKPPETITSKDDGLVPTLESRQLSFHVEEPSVQKDQWSVLSG
ATEQVTDGGYTNDSAVIGNQNFNRQEQMESSKGDFHPSASDHQSILVSLSTRCVWKGSVC
ERAHLLRIKYYGSFDKPLGRFLRDNLFDQDQCCPSCTMPAEAHIHCYTHRQGSLTISVKK
LPELLPGQREGKIWMWHRCLKCPRINGFPPATRRIVMSDAAWGLSFGKFLELSFSNHAAA
SRVANCGHSLHRDCLRFYGFGRMVACFRYASINIYAVTLPPAKLYFNYENQEWLQKESKE
VIKKAEVLFNEVQEALSQISAKTMGAGSKGSTPNKIKLSLEELAGLLEQRKKEYKQMLNV
VKDGQPTIDILLINKLRRLIIFDSYAWDECLAGAANMVRNNYLEAPKNSAPKVMGRNVSL
EKLSDEKVKSIPTHVAICNDSLLQDADYETCLNQGKSFADTSGKFAIPEDVGSDRPPDCR
MEFDPSEGGKDNFVESSQVVKPAHTESQFQATDLSDTLDAAWIGEQTTSENGIFRPPSRA
ASTNGTQIPDLRLLGSESELNFKGGPTNDEHTTQVQLPSPSFYYSLNKNYSLNSRKHIMA
EDRPVYVSSYRELEWRSGARLLLPLGCNDLVLPVYDDEPTSIIAYALTSSEYKAQMSGSD
KSRDRLDSGGSFSLFDSVNLLSLNSLSDLSVDMSRSLSSADEQVSQLLHSSLYLKDLHAR
ISFTDEGPPGKVKYSVTCYYAKEFEALRMICCPSETDFIRSLGRCRKWGAQGGKSNVFFA
KSLDDRFIIKQVTKTELESFIKFGPAYFKYLTESISTKSPTSLAKILGIYQVSSKHLKGG
KEFKMDVLVMENLLFKRNFTRLYDLKGSTRARYNPDTSGSNTVLLDQNLVEAMPTSPIFV
GSKAKRLLERAVWNDTSFLASIHVMDYSLLVGVDEERNELVLGIIDFMRQYTWDKHLETW
VKTSGLLGGPKNSTPTVISPQQYKKRFRKAMTAYFLMVPDQWSPAAVVPSNSSSAEVKEE
EEKDNPQAVGNKS
Download sequence
Identical sequences F4JW01
AT4G33240.3 NP_001190899.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]