SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G34390.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G34390.1
Domain Number 1 Region: 490-628
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 5.1e-16
Family Transducin (alpha subunit), insertion domain 0.0031
Further Details:      
 
Domain Number 2 Region: 465-486,653-795
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.94e-16
Family G proteins 0.0029
Further Details:      
 
Weak hits

Sequence:  AT4G34390.1
Domain Number - Region: 202-258
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0705
Family PHD domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT4G34390.1
Sequence length 861
Sequence
MAAVIRKLLPFPSPNPKRDNRESDDDDETSSGYRIEYSFASEYKGPLIANVPRALPVEVD
QIPTALPVSFSSLRSGISYPVAPLVMTKDTKRPPDSGIEKKNGFVDSAAGSSVVLIGRDV
VSGSSSSSSSKRLDVPEEVKSPADFRLSPSSPLSASAREEDHLDDDRVSDVGPRAVRFVE
PFQSSECDESSYVSDGESIAATHRAERKGKRGSCYRCQLGNRFTEKEVCIVCDAKYCFNC
VRRAMGAMPEGRKCQACIGYRIDESKRASLGKCSRMLKRHLTDSELRQVMNAEITCKANQ
LPSRLIIVNDKPLSEDELYTLQTCPNPPKKLKPGHYWYDKVAGYWGKIGEKPSQIISPNN
SIGGYISEKVSNGDTEIYINGREITKPELTMLKWAGVQCEGKPHFWVDSDGSYREEGQKH
PIGNIWSKKRAKIACAVFSLPVPPASSAVEPYDVPLYEQKMLNKLLLIGSEKGGATTIYK
QARSLYNVSFSLEDRERIKFIIQTNLYTYLAMVLEAHERFEKEMSNDQSSGNVGDETSAK
PGNSINPRLKHFSDWVLKEKEDGNLKIFPPSSRENAQTVADLWRVPAIQATYKRLRDTLP
RNAVYFLERILEISRSEYDPSDMDILQAEGLSSMEGLSCVDFSFPSTSQEESLESDYQHD
TDMKYQLIRLNPRSLGENWKLLEMFEDADLVIFCVSLTDYAENIEDGEGNIVNKMLATKQ
LFENMVTHPSLANKRFLLVLTKFDLLEEKIEEVPLRTCEWFEDFNPLISQNQTSRHNPPM
AQRAFHYIGYKFKRLYDSILEPVNMRGRSFKPKLFVCQVSLESDTVDNALRYAREILKWH
VEETSMFQEMSTTSIEASSSS
Download sequence
Identical sequences A0A178V358 C6KIE6
NP_195165.2.80155 AT4G34390.1 AT4G34390.1 3702.AT4G34390.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]