SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT4G39100.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G39100.1
Domain Number 1 Region: 130-191
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.88e-18
Family PHD domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT4G39100.1
Sequence length 228
Sequence
MPKQKAPRKQLKSYKLKHINKSIQEGDAVLMRSSEPGKPSYVARVEAIETDARGSHAKVR
VRWYYRPEESIGGRRQFHGAKEVFLSDHFDFQSADTIEGKCKVHSFSSYTKLDSVGNDDF
FCRFEYNSTTGAFDPDRVTVFCKCEMPYNPDDLMVQCEECSEWFHPSCIGTTIEEAKKPD
NFYCEECSPQQQNLHNSNSTSNNRDAKVNGKRSLEVTKSKNKHTKRPG
Download sequence
Identical sequences A0A178UWF3 Q9FEN9
NP_568053.1.80155 3702.AT4G39100.1-P AT4G39100.1 AT4G39100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]