SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G04920.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G04920.1
Domain Number 1 Region: 302-414
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.5e-26
Family LexA repressor, N-terminal DNA-binding domain 0.083
Further Details:      
 
Domain Number 2 Region: 14-141
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-20
Family VPS36 N-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT5G04920.1
Sequence length 440
Sequence
MASGSSSIAIGGLFENAEVTTSGRPVLRRNEVECFLLSSIDIDSEDDPPRFTALRSGNLI
LTTHRLIWIPSQSNESVPSSIPLSAVTHIYSHKKSIKSMFHSPRIRFQADPGSIVVTIVF
RGKGDFDGFLSKLWECWRGRAWEEEEKSESETSKSGSGTVAQGLYGNDGTVRMVGLAGIL
RKEQEQWESTDKSLQDAFQDLNALMSKAKEMVSLAEKMRQKLLSAPSSQNGSTDDEEMGS
KEEMQQWMLSVGIISPVTKESAGALYHQELSRQLADFVRIPLEKAGGMISLTDMYYHFNR
ARGTELISPDDLWQACTLWEKFDVPVMLRKFDSGVMVIQNKSHSDEEVMSRIRMLVTKTE
TLRVGVTASDAALTLKIAPAMAKEHLLSAETKGLLCRDMSPDGLRFYFNLFPEIDPTNLH
IVKEFGTYGEWIKATSLLSV
Download sequence
Identical sequences A0A178U8Z1 Q9FF81
3702.AT5G04920.1-P NP_196112.1.80155 AT5G04920.1 AT5G04920.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]