SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G05700.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G05700.1
Domain Number 1 Region: 326-482
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000413
Family N-acetyl transferase, NAT 0.078
Further Details:      
 
Weak hits

Sequence:  AT5G05700.1
Domain Number - Region: 537-581
Classification Level Classification E-value
Superfamily ARM repeat 0.0184
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT5G05700.1
Sequence length 632
Sequence
MSLKNDASSSHDGGSNRESVIDDHGRRKSTCGYCKSPARSSISHGLSAQTLTVYDYQALI
DRGWRRSGTYLYKHEMDKTCCPPYTIRLKASDFVPTKEQQRVSRRLERFLDGKLDVQPRE
QRGASSSGDVSDTRRKTLGAAKSEENKKVEAVMDDLSKNIDQAVQLCIRSGEFPSNMQIP
KASVKKVFCARRKKLAEGTEQILYTSNIAFPIAAAIKRIQTSEKEGINSAEGNRLSPETI
SEMLLSAMHKVGETPDVSIKVCKGHINFLSSAKDSFSDRDVVPNGNISRGANSLDGSETL
HAKKDSENHQARKRKLEIHLKRSSFDPEEHELYKRYQLKVHNDKPGHVVESSYRRFLVDS
PLIDVQPSGDEKVPPCGFGSFHQQYRIDGRLIAVGVVDILPKCLSSVYLFWDPDYAFLSL
GKYSAIQEINWVIENQARCPSLQYYYLGYYIHSCSKMRYKAAYRPSELLCPLRFQWVPFE
VARPMLDKKPYVILSDIAISHNQCSLLAGASETLVEPAASEHEDMEQGETNDNFMGCSDE
DEDEDEDDDDDDDDDEEMYETESEDSHIESDPGSKDNDINNILIGLYGSQYRYKEMRQII
TPVGRKQLEPMLQSYRKVVGAELSERMVYEIN
Download sequence
Identical sequences Q9ZT48
AR3103 AT5G05700.1 AT5G05700.1 3702.AT5G05700.1-P NP_196189.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]