SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G09740.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G09740.2
Domain Number 1 Region: 132-363
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.41e-79
Family N-acetyl transferase, NAT 0.000000451
Further Details:      
 
Domain Number 2 Region: 50-170
Classification Level Classification E-value
Superfamily Chromo domain-like 1.65e-24
Family Chromo barrel domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT5G09740.2
Sequence length 367
Sequence
MGSSANTETNGNAPPPSSNQKPPATNGVDGSHPPPPPLTPDQAIIESDPSKKRKMGMLPL
EVGTRVMCRWRDGKHHPVKVIERRRIHNGGQNDYEYYVHYTEFNRRLDEWTQLDQLDLDS
VECAVDEKVEDKVTSLKMTRHQKRKIDETHIEGHEELDAASLREHEEFTKVKNKVYAQNL
CYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEEAYNLACILTLPSY
QRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYWTRVLLEILKKHKGNISIK
ELSDVTAIKAEDILSTLQSLELIQYRKGQHVICADPKVLDRHLKAAGRGGLDVDASKLIW
TPYKDQS
Download sequence
Identical sequences AT5G09740.2 NP_001078558.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]