SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G09790.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G09790.2
Domain Number 1 Region: 237-367
Classification Level Classification E-value
Superfamily SET domain 5.63e-22
Family Histone lysine methyltransferases 0.01
Further Details:      
 
Domain Number 2 Region: 52-119
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.44e-17
Family PHD domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT5G09790.2
Sequence length 379
Sequence
MATWNASSPAASPCSSRRRTKAPARRPSSESPPPRKMKSMAEIMAKSVPVVEQEEEEDED
SYSNVTCEKCGSGEGDDELLLCDKCDRGFHMKCLRPIVVRVPIGTWLCVDCSDQRPVRRL
SQKKILHFFRIEKHTHQTDKLELSQEETRKRRRSCSLTVKKRRRKLLPLVPSEDPDQRLA
QMGTLASALTALGIKYSDGLNYVPGMAPRSANQSKLEKGGMQVLCKEDLETLEQCQSMYR
RGECPPLVVVFDPLEGYTVEADGPIKDLTFIAEYTGDVDYLKNREKDDCDSIMTLLLSED
PSKTLVICPDKFGNISRFINGINNHNPVAKKKQNCKCVRYSINGECRVLLVATRDISKGE
RLYYDYNGYEHEYPTHHFL
Download sequence
Identical sequences A0A178UEL1 Q8VZJ1
AT5G09790.2 3702.AT5G09790.2-P NP_001078559.1.80155 AT5G09790.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]