SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G12150.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G12150.1
Domain Number 1 Region: 181-371
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-32
Family BCR-homology GTPase activation domain (BH-domain) 0.001
Further Details:      
 
Domain Number 2 Region: 16-130
Classification Level Classification E-value
Superfamily PH domain-like 9.31e-17
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT5G12150.1
Sequence length 827
Sequence
MEASLAVIQRPQAGASNTVYKSGPLFISSKGLGWTSWKKRWFILTRTSLVFFKNDPSALP
QKGGEVNLTLGGIDLNSSGSVVVREDKKLLTVLFPDGRDGRAFTLKAETLDDLYEWKAAL
EQALAQAPNAALVIGQNGIFRTEANNTIEASFNSWRDQRPLKSSVVGRPILLALEEIDGS
PSFLEKALQFLETYGTKVEGILRQSADVEEVERRVQEYEQGKTEFSPEEDPHVVGDCVKH
VLRQLPSSPVPASCCTALLEAYKIDQNEARVNSLRSAIIETFPEPNRRLLLRMLKMMHTI
TSHSSENRMTSSAVAACMSPLLLRPLLAGECDLEGFDTLGDNSAQLLAAANAANNAQAIV
TALLEDYGNMINDEGLGRCSTSTDSHIGDSGPENSSDEEEIVVKHPDLHTLDIEEGETDD
DNDVLLSRKPSESSDYAGSDLYDYKGFGVEDSDAESPRDIHCSVESTDFSARVKKHIEEP
IKDIEVSSVSPTENCYQSGREAIPSVTPSTPLTALRYTTSAEKPASKTTGSSTVNSKRSS
SWGRGNGKKTPAKGSFDSSGNDELLIQRLEHMKDELRQRIAKEAKGNAALQASLERRKQA
LHERRLALEQDVGRLQEQLQAERDLRSALEVGLSISCGQFSSQAADSKTRAELEEIALAE
ADVARLKQKVAELHHQLSQQRQHHLSSLPDAQSHHQFLHNHNTQLKSFQQDFDSILAFVN
HERNQRTDETSLRADWRNGRGNNRQVPGSPSLNAASLGIPMEEYSPVMDYGRHHHPPATS
AALMELTTRLDFFKERRSQLMEQIQNLDLNYGSSSSSLHRSSSPPWN
Download sequence
Identical sequences A0A178UC38 Q9FMP8
AT5G12150.1 3702.AT5G12150.1-P NP_196776.1.80155 AT5G12150.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]