SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G12350.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G12350.1
Domain Number 1 Region: 265-652
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.44e-97
Family Regulator of chromosome condensation RCC1 0.00064
Further Details:      
 
Domain Number 2 Region: 20-128
Classification Level Classification E-value
Superfamily PH domain-like 6.49e-27
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 
Domain Number 3 Region: 652-723
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.17e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 
Weak hits

Sequence:  AT5G12350.1
Domain Number - Region: 860-937
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00445
Family Myosin rod fragments 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT5G12350.1
Sequence length 1075
Sequence
MSRNGRMASDLSRAGPVERDIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWF
SGNEEKHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYSERSLDVICKDKDEAEVW
FTGLKALISHCHQRNRRTESRSDGTPSEANSPRTYTRRSSPLHSPFSSNDSLQKDGSNHL
RIHSPFESPPKNGLDKAFSDMALYAVPPKGFYPSDSATISVHSGGSDSMHGHMRGMGMDA
FRVSMSSAVSSSSHGSGHDDGDALGDVFIWGEGIGEGVLGGGNRRVGSSFDIKMDSLLPK
ALESTIVLDVQNIACGGQHAVLVTKQGESFSWGEESEGRLGHGVDSNIQQPKLIDALNTT
NIELVACGEFHSCAVTLSGDLYTWGKGDFGVLGHGNEVSHWVPKRVNFLLEGIHVSSIAC
GPYHTAVVTSAGQLFTFGDGTFGVLGHGDKKSVFIPREVDSLKGLRTVRAACGVWHTAAV
VEVMVGSSSSSNCSSGKLFTWGDGDKGRLGHGNKEPKLVPTCVAALVEPNFCQVACGHSL
TVALTTSGHVYTMGSPVYGQLGNSHADGKTPNRVEGKLHKSFVEEIACGAYHVAVLTSRT
EVYTWGKGSNGRLGHGDVDDRNSPTLVESLKDKQVKSIACGTNFTAAVCIHRWASGMDQS
MCSGCRQPFSFKRKRHNCYNCGLVFCHSCTSKKSLKACMAPNPNKPYRVCDKCFNKLKKT
METDPSSHSSLSRRGSINQGSDPIDKDDKFDSRSDGQLARFSLMESMRQVDSRHKKNKKY
EFNSSRVSPIPSGSSQRGALNIAKSFNPVFGASKKFFSASVPGSRIVSRATSPISRRPSP
PRSTTPTPTLSGLATPKFVVDDTKRTNDNLSQEVVKLRSQVESLTRKAQLQEVELERTTK
QLKEALAITNEETTRCKAAKEVIKSLTAQLKDMAERLPVGSARTVKSPPSLNSFGSSPGR
IDPFNILNQANSQESEPNGITTPMFSNGTMTPAFGNGEATNEARNEKEWVEQDEPGVYIT
LTALAGGARDLKRVRFSRKRFSEIQAEQWWADNRGRVYEQYNVRMVDKASEDLPR
Download sequence
Identical sequences F4K0X5
NP_568268.3.80155 AT5G12350.1 3702.AT5G12350.1-P AT5G12350.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]