SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G12400.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G12400.1
Domain Number 1 Region: 592-654
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.64e-16
Family PHD domain 0.0026
Further Details:      
 
Domain Number 2 Region: 1520-1585
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000171
Family PHD domain 0.017
Further Details:      
 
Weak hits

Sequence:  AT5G12400.1
Domain Number - Region: 1320-1368
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000408
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT5G12400.1
Sequence length 1602
Sequence
MELVGKVVRKEIQGIGFCSGTVRSRDSSGFFEIVYENGVTEISELDEVVALVMGDGKSQE
NSVPVKKKRVGRKPKKRSRVARVVEIKRESSGLNEVNVDLNDGVAENSGVSEENLRGNVD
LNCGPVETLGRTWDSSVTDLNRTVSESETGFDLTTGLDWNSNENLGLVNVNIDYEENCSD
KRKWDIDLNMDASCDLDNAAICDFSGQKREVGFDLNVEVDVENSKDEEYSQMNGNDIVQE
INMQDGNGAQDNIETGEYKEVHVAEVSSAELLEEIQKQNIVSPQDLKNLNSNGVEKDPDL
PHHDAKTVDETLSDRGNSGEYTSGRRKRRKASDNPKFMSEPQLRRSARRRLARSPVSSTV
TACFVEEVSPSPSISSLTEEKTWIVDGKADNISALPPKPQLPPSSPILDLDGLPVLDVFT
AYSCLRSFSTLLFLSPFELKDFVEALRCMSPSLLFDSIHVSVLQILRKHLKQLAAEGDLS
ASACLRSLDWDTLDVVTYPLFVVEYLLCSGSKDNPGLDLTRLNFFRNDYFRQPVNLKIEI
LSRLCDDMTDAEVVRAELNKRSFAAEFEMELDRKTNTEVRRRKRTMMELADDFSLNNEVI
DTSFDRNSDDCCFCKMDGSLLCCDGCPAAYHSKCVGLASHLLPEGDWYCPECAFDRRAPG
LKPDKQIRGAEFIEIDPHGRKYYSSCGYLLVIDTDGTGSLNYYHVTDVNLVLEQLKSCSS
FYAGVVSAIRKHLDIPVRPVRTISGLNSQMSVCMDKSVKGMIPSIDGFGAPLPASEKQST
SGAKKKLNKATSNGWSHNHGPRTRRKISDSATALDILNMSSEGSAETVQNGSDVQRLHEP
ASSSMLDIMKEPNMNSQNLAKINTRKGTKPNVQTETGYRNQYIFAQMTRSVYEEMIRKSP
IRTNDMRSDEEIASTQVRTILMKTTKFQWRNIQSLYLDAWKENCGWCHSCKNSSEDAGTE
INCLFNMSLGALRGLSESEVANIQSFEKNSHLLAIICQILSLESRLQGLLVGPWLNPQHS
SFWREHILKASNISSLKHLLVDLEANLHHRVLSLEWLSHVDAAVVMGSAIHILIASTRSW
SKTAIGKRRGTLLDSGVNPTAKKNGGLTMCWWRGGQLSRRLFNWKVLPRALISKAARQGG
SMNIPGIFYPENSESAKRSRRVAWEAAVESSTTSEQLGLQIRTLQSYIKWDDIENSHLLP
TLDKESRKSARLFKKAIVRRKCTEEETVKYLLDFGKRRNIPDVVSKNGCMVEESSSGRKR
FWLNESHVPLHLVKGFEEKKAVRKTSKPGGSFRHSEIGKLRKRSSEGKGFSYLFERAERS
ESSLCEQCKKVVPLSEAASCHICKGVFHKKHIRRGEKEGMYICVPCKSEVLSKEQPTVRK
RGRPPGSFRKKIGVQTQKRKKVIAARKSPRLKKTKTSMAERIAIRLKNHKKVVASKPLRR
SGRQLKHVIRLQDESKVPEGSKKRKLETKRGRGRPKKVKQEISIRKARTDRCLNYWLNGL
LLSRKAGNERVHQFHRERYYVPLENSDSDHDQPKCHLCGSIESKSGSTFISCELCGEWYH
GDAYGLNEKNSSMVIGFRCHLCRKQSSPTCPHMRSTTSPVAS
Download sequence
Identical sequences F4K0Y2
AT5G12400.1 NP_568273.2.80155 AT5G12400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]