SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G13300.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G13300.1
Domain Number 1 Region: 6-241,290-315
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.08e-64
Family BAR domain 0.00085
Further Details:      
 
Domain Number 2 Region: 502-638
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.4e-37
Family Pyk2-associated protein beta ARF-GAP domain 0.00027
Further Details:      
 
Domain Number 3 Region: 655-678,726-816
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.05e-24
Family Ankyrin repeat 0.00065
Further Details:      
 
Domain Number 4 Region: 293-333,375-446
Classification Level Classification E-value
Superfamily PH domain-like 9.73e-23
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT5G13300.1
Sequence length 827
Sequence
MHFTKLDDSPMFRKQLQSMEESAEILRERSLKFYKGCRKYTEGLGEAYDGDIAFASALET
FGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHILNDRLLQFANMDLHEVKE
ARKRFDKASLTYDQAREKFLSLRKGTKSDVAAALEQELHTSRSMFEQARFNLVTALSNVE
AKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNEK
MQEYKRQVDRESRWGSNGSNGSPNGDGIQAIGRSSHKMIDAVMQSAARGKVQTIRQGYLS
KRSSNLRGDWKRRFFVLDSRGMLYYYRKQCSKPSGSGSQLSGQRNSSELGSGLLSRWLSS
NNHGHGGVHDEKSVARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMD
WIEKITGVIASLLSSQVPEQRLPGSPMGSGHHRSASESSSYESSEYDHPTTEEFVCERSF
LGYNERPSRSFQPQRSIRKGEKPIDALRKVCGNDKCADCGAPEPDWASLNLGVLVCIECS
GVHRNLGVHISKVRSLTLDVKVWEPSVISLFQALGNTFANTVWEELLHSRSAIHFDPGLT
VSDKSRVMVTGKPSYADMISIKEKYIQAKYAEKLFVRRSRDSDFPQSAAQQMWDAVSGND
KKAVYRLIVNGDADVNYVYDQTSSSSLTLSRVILVPERPKREDVLLRLRNELLDRTGSSS
NISPEGSGGSSLLHCACEKADLGMVELLLQYGANVNASDSSGQTPLHCCLLRGKVTIARL
LLTRGADPEAMNREGKTALDIAAESNFTDPEVLALLSDTNGYNHRQC
Download sequence
Identical sequences Q5W7F2
NP_196834.3.80155 AT5G13300.1 AT5G13300.1 3702.AT5G13300.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]