SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G15540.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G15540.1
Domain Number 1 Region: 636-672,868-1029,1151-1352,1384-1468
Classification Level Classification E-value
Superfamily ARM repeat 1.63e-38
Family HspBP1 domain 0.088
Further Details:      
 
Domain Number 2 Region: 687-756
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000638
Family PHD domain 0.028
Further Details:      
 
Weak hits

Sequence:  AT5G15540.1
Domain Number - Region: 297-407,482-553,595-674,779-810
Classification Level Classification E-value
Superfamily ARM repeat 0.00454
Family Armadillo repeat 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT5G15540.1
Sequence length 1846
Sequence
MSNPSSSGLGSSSGLTHFGIGLANTVQSEVTPYLPLPSLPIFCGAAEPGEFKLFDEVGQG
SGYRSLDRSEILAQSSRIANMLHETDVSYLDLRNEARAPDCNSGEHFQLYDLVLRCNPGA
FEYVTPGPTCDPLFTNEGPQKIISEPSVPVKMQRQTDTHLARSIEPEPVKRVLRPNHVED
HSWQHETLTNQSPKDVTAYDSRPETITMNELSASKKPKGKKKRKDDLSSVQPDPSVLQES
IVQNFCEMLEDFCGRAEVPGDDRDEAEWSSVPVDEVRVLINELMTIRSKMLLHMVPVDIL
SRLLRTLDHQIHRAEGLSIYSEHSDSDSVLLVLGALESIHASLAVMANSDMPKQLYKEEI
IERILEFSRHQMMAVMSAYDPSYRTGSKPAENLAFEGDDDDDNPDHDMGSASKRRRIVKN
SKVKKASVNRISGAVNTALQKLCTILGLLKDLLLVERLSDSCILQLLKTSITTFLVENIQ
ILQLKAISLIGGIYNSYSQHRTYVIDEISQLLWKLPSSKRALRAYLLPDEEQRQIQMVTA
LLIQLVHNSTSLPETSRQAASGNSILETSVDVGYLTKCHEAATETCCLFWTRVLERFTSF
KGQDASEIKLIIENLVMDLLTALNLPEYPSVSPILEVLCVILLHNAGLKSKDVSARIMAI
ELLGTIAARLKRDAVLCSKDRFWTLLESDSEISVDQVCTKDCTFCLGKRAGNLLVCQICQ
RRFHGDCLGLKELDISSRNWHCPLCVCKRQLLVLQSYCKTDTKGTGKLESEESIENPSMI
TKTEVVQQMLLNYLQDVGSADDVHTFICWFYLCLWYKDVPKSQNKFKYYIARLKAKSIIR
NSGATTSFLTRDAIKQITLALGMNSSFSRGFDKILNMLLASLRENAPNIRAKALRAVSII
VEADPEVLCDKRVQLAVEGRFCDSAISVREAALELVGRHIASHPDVGIKYFEKVAERIKD
TGVSVRKRAIKIIRDMCTSNPNFSEFTSACAEILSRISDDESSVQDLVCKTFYEFWFEEP
PGHHTQFASDASSIPLELEKKTKQMVGLLSRTPNQQLLVTIIKRALALDFFPQAAKAAGI
NPVALASVRRRCELMCKCLLEKILQVEEMSREEGEVQVLPYVLVLHAFCLVDPGLCTPAS
DPTKFVITLQPYLKSQADSRTGAQLLESIIFIIDSVLPLIRKLPLSVTEDLEQDLKHMIV
RHSFLTVVHACVRCLCSVSKLAGKGVSIVEHLLQFFFKRLEAQGSDNTQIAGRSLFCLGL
LIRHGNSLISTSGGKNFNLSGCLNLFKRHLRTEDIALKVRSLQALGFILIARPEYMLEED
IGKIIETTLADEANGRMKMQALQNMYEYLLDAEKQLGSEKASDNTVNSVEQGGHNVPVAA
GAGDTNICGGIVQLFWDKILGRCLDFDDQIRQTSLKIVEVVLRQGLVHPITCVPYLIALE
TDPQEANQKLAHHLLMNMHEKYPAFFESRLGDGLQMSFIFMQSISQVTSEPNQSLQQKGS
TNMLGKNDHASSTLTQARLGVSRIYKLIRGNRVSRNKFMTSIVRKFDNPTWNGSVISFLK
YCTETLALLPFTSPDEPLYLVYSINRVMQIRAGAVESNLKALLHKDSAKTQHGNGAYQQD
PIPGHMNMMDLNTRIQEEPRHWNSYGHATLIDLNGSVYQDSRDQFTSYQVHNGKADVHKM
TSSDPPELSTDDLQKIQVDCLAAIAIQLLLKLKRYLKVTYSLNDDRCQAYSPTEPLKPGD
PLSRQSVAFDLSETRTDLPSTYQDLVQRYQEFKNAMREDTVDFTIYSTNVKRKRPTPRKT
SRSAKKTVAYNEDDDDDDNDDRGWHGGGGRGAARRLNYSTRSSNRR
Download sequence
Identical sequences A5HEI1
3702.AT5G15540.1-P AT5G15540.1 NP_197058.2.80155 AT5G15540.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]