SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G15540.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G15540.2
Domain Number 1 Region: 647-670,866-1027,1149-1350,1382-1466
Classification Level Classification E-value
Superfamily ARM repeat 3.35e-38
Family HspBP1 domain 0.088
Further Details:      
 
Domain Number 2 Region: 685-754
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000638
Family PHD domain 0.028
Further Details:      
 
Weak hits

Sequence:  AT5G15540.2
Domain Number - Region: 295-405,480-551,593-672,777-808
Classification Level Classification E-value
Superfamily ARM repeat 0.00597
Family Armadillo repeat 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT5G15540.2
Sequence length 1844
Sequence
MSNPSSSGLGSSSGLTHFGIGLANTVQSEVTPYLPLPSLPIFCGAAEPGEFKLFDEVGQG
SGYRSLDRSEILAQSSRIANMLHETDVSYLDLRNEARAPDCNSGEHFQLYDLVLRCNPGA
FDLSGPTCDPLFTNEGPQKIISEPSVPVKMQRQTDTHLARSIEPEPVKRVLRPNHVEDHS
WQHETLTNQSPKDVTAYDSRPETITMNELSASKKPKGKKKRKDDLSSVQPDPSVLQESIV
QNFCEMLEDFCGRAEVPGDDRDEAEWSSVPVDEVRVLINELMTIRSKMLLHMVPVDILSR
LLRTLDHQIHRAEGLSIYSEHSDSDSVLLVLGALESIHASLAVMANSDMPKQLYKEEIIE
RILEFSRHQMMAVMSAYDPSYRTGSKPAENLAFEGDDDDDNPDHDMGSASKRRRIVKNSK
VKKASVNRISGAVNTALQKLCTILGLLKDLLLVERLSDSCILQLLKTSITTFLVENIQIL
QLKAISLIGGIYNSYSQHRTYVIDEISQLLWKLPSSKRALRAYLLPDEEQRQIQMVTALL
IQLVHNSTSLPETSRQAASGNSILETSVDVGYLTKCHEAATETCCLFWTRVLERFTSFKG
QDASEIKLIIENLVMDLLTALNLPEYPSVSPILEVLCVILLHNAGLKSKDVSARIMAIEL
LGTIAARLKRDAVLCSKDRFWTLLESDSEISVDQVCTKDCTFCLGKRAGNLLVCQICQRR
FHGDCLGLKELDISSRNWHCPLCVCKRQLLVLQSYCKTDTKGTGKLESEESIENPSMITK
TEVVQQMLLNYLQDVGSADDVHTFICWFYLCLWYKDVPKSQNKFKYYIARLKAKSIIRNS
GATTSFLTRDAIKQITLALGMNSSFSRGFDKILNMLLASLRENAPNIRAKALRAVSIIVE
ADPEVLCDKRVQLAVEGRFCDSAISVREAALELVGRHIASHPDVGIKYFEKVAERIKDTG
VSVRKRAIKIIRDMCTSNPNFSEFTSACAEILSRISDDESSVQDLVCKTFYEFWFEEPPG
HHTQFASDASSIPLELEKKTKQMVGLLSRTPNQQLLVTIIKRALALDFFPQAAKAAGINP
VALASVRRRCELMCKCLLEKILQVEEMSREEGEVQVLPYVLVLHAFCLVDPGLCTPASDP
TKFVITLQPYLKSQADSRTGAQLLESIIFIIDSVLPLIRKLPLSVTEDLEQDLKHMIVRH
SFLTVVHACVRCLCSVSKLAGKGVSIVEHLLQFFFKRLEAQGSDNTQIAGRSLFCLGLLI
RHGNSLISTSGGKNFNLSGCLNLFKRHLRTEDIALKVRSLQALGFILIARPEYMLEEDIG
KIIETTLADEANGRMKMQALQNMYEYLLDAEKQLGSEKASDNTVNSVEQGGHNVPVAAGA
GDTNICGGIVQLFWDKILGRCLDFDDQIRQTSLKIVEVVLRQGLVHPITCVPYLIALETD
PQEANQKLAHHLLMNMHEKYPAFFESRLGDGLQMSFIFMQSISQVTSEPNQSLQQKGSTN
MLGKNDHASSTLTQARLGVSRIYKLIRGNRVSRNKFMTSIVRKFDNPTWNGSVISFLKYC
TETLALLPFTSPDEPLYLVYSINRVMQIRAGAVESNLKALLHKDSAKTQHGNGAYQQDPI
PGHMNMMDLNTRIQEEPRHWNSYGHATLIDLNGSVYQDSRDQFTSYQVHNGKADVHKMTS
SDPPELSTDDLQKIQVDCLAAIAIQLLLKLKRYLKVTYSLNDDRCQAYSPTEPLKPGDPL
SRQSVAFDLSETRTDLPSTYQDLVQRYQEFKNAMREDTVDFTIYSTNVKRKRPTPRKTSR
SAKKTVAYNEDDDDDDNDDRGWHGGGGRGAARRLNYSTRSSNRR
Download sequence
Identical sequences NP_001190317.1.80155 AT5G15540.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]