SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G15770.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G15770.1
Domain Number 1 Region: 4-137
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.67e-33
Family SCOPe 0.00000883
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT5G15770.1
Sequence length 149
Sequence
MAETFKIRKLEISDKRKGFIELLGQLTVTGSVTDEEFDRRFEEIRSYGDDHVICVIEEET
SGKIAATGSVMIEKKFLRNCGKAGHIEDVVVDSRFRGKQLGKKVVEFLMDHCKSMGCYKV
ILDCSVENKVFYEKCGMSNKSIQMSKYFD
Download sequence
Identical sequences A0A178U7Q6 Q9LFU9
AT5G15770.1 NP_197081.1.80155 3702.AT5G15770.1-P 3t90_A GO.21203 000149284|e3t90A1|213.1.1.111|A:1-149 cath|current|3t90A00/3-149 AT5G15770.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]