SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G17430.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G17430.1
Domain Number 1 Region: 311-371
Classification Level Classification E-value
Superfamily DNA-binding domain 1.7e-17
Family GCC-box binding domain 0.0014
Further Details:      
 
Domain Number 2 Region: 209-278
Classification Level Classification E-value
Superfamily DNA-binding domain 3.01e-17
Family GCC-box binding domain 0.0011
Further Details:      
 
Weak hits

Sequence:  AT5G17430.1
Domain Number - Region: 119-168
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 0.00916
Family Obg GTP-binding protein N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT5G17430.1
Sequence length 584
Sequence
MNSMNNWLGFSLSPHDQNHHRTDVDSSTTRTAVDVAGGYCFDLAAPSDESSAVQTSFLSP
FGVTLEAFTRDNNSHSRDWDINGGACNNINNNEQNGPKLENFLGRTTTIYNTNETVVDGN
GDCGGGDGGGGGSLGLSMIKTWLSNHSVANANHQDNGNGARGLSLSMNSSTSDSNNYNNN
DDVVQEKTIVDVVETTPKKTIESFGQRTSIYRGVTRHRWTGRYEAHLWDNSCKREGQTRK
GRQVYLGGYDKEEKAARAYDLAALKYWGTTTTTNFPLSEYEKEVEEMKHMTRQEYVASLR
RKSSGFSRGASIYRGVTRHHQHGRWQARIGRVAGNKDLYLGTFGTQEEAAEAYDIAAIKF
RGLSAVTNFDMNRYNVKAILESPSLPIGSSAKRLKDVNNPVPAMMISNNVSESANNVSGW
QNTAFQHHQGMDLSLLQQQQERYVGYYNGGNLSTESTRVCFKQEEEQQHFLRNSPSHMTN
VDHHSSTSDDSVTVCGNVVSYGGYQGFAIPVGTSVNYDPFTAAEIAYNARNHYYYAQHQQ
QQQIQQSPGGDFPVAISNNHSSNMYFHGEGGGEGAPTFSVWNDT
Download sequence
Identical sequences A7L9U1 Q6PQQ4
AT5G17430.1 NP_197245.2.80155 AT5G17430.1 3702.AT5G17430.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]