SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G19390.4 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G19390.4
Domain Number 1 Region: 176-369
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-35
Family BCR-homology GTPase activation domain (BH-domain) 0.001
Further Details:      
 
Domain Number 2 Region: 15-131
Classification Level Classification E-value
Superfamily PH domain-like 2.39e-17
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT5G19390.4
Sequence length 714
Sequence
MEASLAALERPRGSASNTVFKSGPLFISSKGLGWTSWKKRWFILTRTSLVFFKNDPGTLP
QKGGEVNLTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRAFTLKAETFEDLYEWKTAL
EQALAQAPNAALIMGQNGIFRAETNEAIEGREKRPLKSLVVGRPILLALEDIDGSPSFLE
KALQFIEKYGTKIEGILRQSADVEEVERRVQEYEQGKTEFTFDEDPHVVGDCIKHVLREL
PSSPVSASCCTALLEAYRIESKEARISSLRSAIAETFPEPNRRLLQRILKMMHTISSHSH
ENRMNPNAVAACMAPLLLRPLLAGECDLEDDFDGGEDNSAQLLAAANAANNAQAIITVLL
EDYGSIFDEENIQRCSISTESHIGNSGPDDSSDDDNNMKNGYHNADNEVEPVTDDDNDRA
LSGKMSESSGCTGSDLYEYKGFVADDSDIESPRDTNGPRCNSNIRTDHLMRNPFVNSTDQ
QAGEQIGDDPTKYGVNSCLAHVSESYQQSGTGLNVPTHGNTLAAPGLESPSAKSVNKGTP
SSVHAKRATFWGRGSARKISTDGSFDSSGEDELAIQRLETTKNELRQRIAKEARGNAILQ
ASLERRKQALHERRLSLEQDVSRLQEQLQAERDLRAALEVGLSMSSGQFSSHGVDSKTRA
ELEEIALAEADVARLKQKVAELHHQLNQQRQTHFGSFSDARDTHQYLQNHNPQK
Download sequence
Identical sequences AT5G19390.4 NP_001031905.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]