SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G19420.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G19420.1
Domain Number 1 Region: 269-656
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.8e-98
Family Regulator of chromosome condensation RCC1 0.0006
Further Details:      
 
Domain Number 2 Region: 21-129
Classification Level Classification E-value
Superfamily PH domain-like 5.85e-28
Family Pleckstrin-homology domain (PH domain) 0.004
Further Details:      
 
Domain Number 3 Region: 657-727
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.45e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0023
Further Details:      
 
Weak hits

Sequence:  AT5G19420.1
Domain Number - Region: 864-941
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0225
Family Myosin rod fragments 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT5G19420.1
Sequence length 1105
Sequence
MSRNGRMTPSDLSRAGPVTRDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIW
FSGKEEKHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYDERSLDLICKDKDEAEV
WFSGLKALISRCHQRKWRTESRSDGTPSEANSPRTYTRRSSPLHSPFSSNESFQKEGSNH
LRLHSPYESPPKNGVDKAFSDMSLYAVPPKGFFPPGSATMSVHSLSSGGSDTLHGHMKGM
GMDAFRVSLSSAISSSSHGSGHDDGDTLGDVFMWGEGIGEGVLGGGNHRVGSSLEIKMDS
LLPKALESTIVLDVQNIACGGQHAVLVTKQGESFSWGEESEGRLGHGVDSNVQHPKLIDA
LNTTNIELVACGEYHSCAVTLSGDLYTWGKGDFGILGHGNEVSHWVPKRVNFLMEGIHVS
SIACGPYHTAVVTSAGQLFTFGDGTFGVLGHGDRKSVFIPREVDSLKGLRTVRAACGVWH
TAAVVEVMVGSSSSSNCSSGKLFTWGDGDKSRLGHGDKEPKLVPTCVAALVEPNFCQVAC
GHSLTVALTTSGHVYTMGSPVYGQLGNPHADGKVPTRVDGKLHKSFVEEIACGAYHVAVL
TSRTEVYTWGKGSNGRLGHGDADDRNSPTLVESLKDKQVKSIACGSNFTAAVCLHKWASG
MDQSMCSGCRQPFNFKRKRHNCYNCGLVFCHSCSNKKSLKACMAPNPNKPYRVCDRCFNK
LKKAMETDPSSHSSLSRRESVNQGSDAIDRDEKLDTRSDGQLARFSLLEPMRQVDSRSKK
NKKYEFNSSRVSPIPSGGSHRGSLNITKSFNPTFGSSKKFFSASVPGSRIASRATSPISR
RPSPPRSTTPTPTLSGLTTPKIVVDDTKRSNDNLSQEVVMLRSQVENLTRKAQLQEVELE
RTTKQLKEALAIASEESARCKAAKEVIKSLTAQLKDMAERLPVGSARTVKSPSLNSFGSS
PDYAAPSSNTLNRPNSRETDSDSLTTVPMFSNGTSTPVFDSGSYRQQANHAAEAINRIST
RSKESEPRNENEWVEQDEPGVYITLTALAGGARDLKRVRFSRKRFSEKQAEEWWAENRGR
VYEQYNVRIVVDKSSVGVGSEDLGH
Download sequence
Identical sequences F4K149
3702.AT5G19420.1-P NP_197443.3.80155 AT5G19420.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]